diff --git a/docs/.buildinfo b/docs/.buildinfo index a81178ed..507bc923 100644 --- a/docs/.buildinfo +++ b/docs/.buildinfo @@ -1,4 +1,4 @@ # Sphinx build info version 1 # This file hashes the configuration used when building these files. When it is not found, a full rebuild will be done. -config: e41613e939dfe6ab7008de864b4e64a8 +config: 9e8b58068fa2090b104690bfc9c25e35 tags: 645f666f9bcd5a90fca523b33c5a78b7 diff --git a/docs/README.html b/docs/README.html deleted file mode 100644 index 60b381ed..00000000 --- a/docs/README.html +++ /dev/null @@ -1,234 +0,0 @@ - - - - - - - - - - - Setup — porymap documentation - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
- - - -
- - - - - -
- -
- - - - - - - - - - - - - - - - - -
- - - - -
-
-
-
- -

This directory holds the sources that build the porymap documentation website. It uses Sphinx to build a static website, and copy the results to the docs/ directory for GitHub Pages.

-
-

Setup

-

Sphinx uses Python, so you can use pip to install the dependencies:

-
pip install -r requirements.txt
-
-
-
-
-

Build

-

This will build the static site and copy the files to the root-level docs/ directory. The GitHub Pages site will automatically update when the commit is merged to porymap’s master branch.

-
make github
-
-
-
- - -
- -
- - -
-
- -
- -
- - - - - - - - - - - - \ No newline at end of file diff --git a/docs/_images/event-heal-location.png b/docs/_images/event-heal-location.png new file mode 100644 index 00000000..16ec90f1 Binary files /dev/null and b/docs/_images/event-heal-location.png differ diff --git a/docs/_images/event-hidden-item.png b/docs/_images/event-hidden-item.png index 20475430..2377edfc 100644 Binary files a/docs/_images/event-hidden-item.png and b/docs/_images/event-hidden-item.png differ diff --git a/docs/_images/event-object.png b/docs/_images/event-object.png index 6699033c..e019caba 100644 Binary files a/docs/_images/event-object.png and b/docs/_images/event-object.png differ diff --git a/docs/_images/event-sign.png b/docs/_images/event-sign.png index 5e279eb3..5d4c6596 100644 Binary files a/docs/_images/event-sign.png and b/docs/_images/event-sign.png differ diff --git a/docs/_images/event-trigger.png b/docs/_images/event-trigger.png index c2805341..c922b06d 100644 Binary files a/docs/_images/event-trigger.png and b/docs/_images/event-trigger.png differ diff --git a/docs/_images/map-events.png b/docs/_images/map-events.png index 135e383f..9a4d3f5d 100644 Binary files a/docs/_images/map-events.png and b/docs/_images/map-events.png differ diff --git a/docs/_images/map-header.png b/docs/_images/map-header.png index 9b446985..fe31076b 100644 Binary files a/docs/_images/map-header.png and b/docs/_images/map-header.png differ diff --git a/docs/_images/new-map-options-window.png b/docs/_images/new-map-options-window.png new file mode 100644 index 00000000..caad5a11 Binary files /dev/null and b/docs/_images/new-map-options-window.png differ diff --git a/docs/_images/right-click-layout-sort.png b/docs/_images/right-click-layout-sort.png new file mode 100644 index 00000000..f96265b5 Binary files /dev/null and b/docs/_images/right-click-layout-sort.png differ diff --git a/docs/_sources/README.md.txt b/docs/_sources/README.md.txt deleted file mode 100644 index 676b538d..00000000 --- a/docs/_sources/README.md.txt +++ /dev/null @@ -1,13 +0,0 @@ -This directory holds the sources that build the porymap documentation website. It uses Sphinx to build a static website, and copy the results to the `docs/` directory for GitHub Pages. - -## Setup -Sphinx uses Python, so you can use `pip` to install the dependencies: -``` -pip install -r requirements.txt -``` - -## Build -This will build the static site and copy the files to the root-level `docs/` directory. The GitHub Pages site will automatically update when the commit is merged to porymap's `master` branch. -``` -make github -``` diff --git a/docs/_sources/index.rst.txt b/docs/_sources/index.rst.txt index 4b13288f..9fa9081c 100644 --- a/docs/_sources/index.rst.txt +++ b/docs/_sources/index.rst.txt @@ -16,6 +16,7 @@ Porymap Documentation manual/editing-map-header manual/editing-map-connections manual/editing-wild-encounters + manual/creating-new-maps manual/region-map-editor manual/scripting-capabilities manual/project-files diff --git a/docs/_sources/manual/creating-new-maps.rst.txt b/docs/_sources/manual/creating-new-maps.rst.txt new file mode 100644 index 00000000..3f7387c7 --- /dev/null +++ b/docs/_sources/manual/creating-new-maps.rst.txt @@ -0,0 +1,73 @@ +.. _creating-new-maps: + +***************** +Creating New Maps +***************** + +Creating a new map in porymap is easy! Just click *Tools -> New Map...*. +Alternatively, in any of the map list sort modes, you can right click on a folder +in order to add a new map to the folder. + +For example, when sorting maps by their layout, you can add a new Pokemon Center from the existing layout. + +.. figure:: images/creating-new-maps/right-click-layout-sort.png + :alt: Add New Map with Layout + + Add New Map with Layout + +New Map Options +--------------- + +The popup window when you create a new map will display some options in order to customize your new map. + +.. figure:: images/creating-new-maps/new-map-options-window.png + :alt: New Map Options Window + + New Map Options Window + +The options you see may be different depending on your base project, but they are: + +Name + The name of the new map. This cannot be changed in porymap. + +Group + Which map group the new map will beling to. This cannot be changed in porymap. + +Map Width + The width (in metatiles) of the map. This can be changed in porymap. + +Map Height + The height (in metatiles) of the map. This can be changed in porymap. + +Border Width + The width (in metatiles) of the map border blocks. This can be changed in porymap. + +Border Height + The height (in metatiles) of the map border blocks. This can be changed in porymap. + +Primary Tileset + The map's primary tileset. This can be changed in porymap. + +Secondary Tileset + The map's secondary tileset. This can be changed in porymap. + +Type + Whether this map is an indoor or outdoor map. This can be changed in porymap. + +Location + The region map section this map exists in. This can be changed in porymap. + +Can Fly To + Whether a heal location event will be created with this map. This cannot be changed in porymap. + +Allow Running + Whether the player can sprint on this map. This can be changed in porymap. + +Allow Biking + Whether the player can use the bike on this map. This can be changed in porymap. + +Allow Escape Rope + Whether the user can escape from this map. This can be changed in porymap. + +Floor Number + The floor number for this map if it is associated with an elevator. This can be changed in porymap. diff --git a/docs/_sources/manual/editing-map-events.rst.txt b/docs/_sources/manual/editing-map-events.rst.txt index 89bc57f4..25f45263 100644 --- a/docs/_sources/manual/editing-map-events.rst.txt +++ b/docs/_sources/manual/editing-map-events.rst.txt @@ -9,7 +9,7 @@ Events are what bring your maps to life. They include NPCs, signposts, warps, s Map Events View -All of the events are visible on the map. The Event Details window on the right displays the properties of the currently-selected event. If you look closely, you'll see that the woman NPC near the Pokémon Center has a pink border around it because it's selected. To select a different event, simple click on an event in the map area. Alternatively, you can use the spinner at the top of the event properties window. Multiple events can be selected at the same time by holding ``Ctrl`` and clicking another event. +All of the events are visible on the map. The Event Details window on the right displays the properties of the currently-selected event. If you look closely, you'll see that the woman NPC near the Pokémon Center has a pink border around it because it's selected. To select a different event, simply click on an event in the map area. Alternatively, you can use the spinner at the top of the event properties window. Multiple events can be selected at the same time by holding ``Ctrl`` and clicking another event. .. figure:: images/editing-map-events/event-id-spinner.png :alt: Event Id Spinner @@ -65,11 +65,14 @@ Event Flag The flag value that controls if the object is visible. If the flag is set (equal to 1), then the object will be invisible. If the Event Flag is set to `0`, then the object will always be visible because `0` means "no flag". Trainer Type - `NONE`, `NORMAL`, or `SEE ALL DIRECTIONS`. If the object is a trainer, `NORMAL` means that the trainer will spot the player in the object's line-of-sight. + The trainer type used by the object. If the object is a trainer, `TRAINER_TYPE_NORMAL` means that the trainer will spot the player in the object's line-of-sight. Sight Radius or Berry Tree ID If the object is a trainer, this property control how many tiles the trainer can see to spot the player for battle. If the object is a berry tree, this specifies the global id of the berry tree. Each berry tree in the game has a unique berry tree id. +In Connection + Exclusive to pokefirered. Used to replace objects that are visible in a map's connection with their corresponding object on the connecting map. When checked, these objects will make odd use of other fields; its trainer type value will be the connecting map number, its Sight Radius / Berry Tree Id will be the connecting map group, and its z coordinate will be the object's local id on the connecting map. + .. _event-warps: Warp Events @@ -116,7 +119,7 @@ Var Value Weather Trigger Events ---------------------- -Weather trigger events are a very specific type of trigger. When the player walks over a weather trigger, the overworld's weather will transition to the specified weather type. +Weather trigger events are a very specific type of trigger. When the player walks over a weather trigger, the overworld's weather will transition to the specified weather type. This event type is unavailable for pokefirered projects; the functions to trigger weather changes were dummied out. .. figure:: images/editing-map-events/event-weather-trigger.png :alt: Weather Trigger Event Properties @@ -167,10 +170,17 @@ Item Flag This flag is set when the player receives the hidden item. +Quantity + Exclusive to pokefirered. The number of items received when the item is picked up. + +Requires Itemfinder + Exclusive to pokefirered. When checked, the hidden item can only be received by standing on it and using the Itemfinder. + Secret Base Event ----------------- This is the event used to mark entrances to secret bases. This event will only be functional on certain metatiles. Unfortunately, they are hardcoded into the game's engine (see ``sSecretBaseEntranceMetatiles`` in ``src/secret_base.c``). +This event type is unavailable for pokefirered projects; secret bases do not exist there. .. figure:: images/editing-map-events/event-secret-base.png :alt: Secret Base Event Properties @@ -183,6 +193,22 @@ Id Secret Base Id The id of the destination secret base. +Heal Location / Healspots +------------------------- + +This event is used to control where a player will arrive when they white out or fly to the map. The white out functions a little differently between game versions. For pokeemerald and pokeruby players will arrive at the event's coordinates after a white out, while in pokefirered they will arrive on the map set in ``Respawn Map`` and at hardcoded coordinates (see ``SetWhiteoutRespawnWarpAndHealerNpc`` in ``src/heal_location.c``). + +.. figure:: images/editing-map-events/event-heal-location.png + :alt: Heal Location Properties + + Heal Location Properties + +Respawn Map + Exclusive to pokefirered. The map where the player will arrive when they white out (e.g. inside the PokéCenter that the heal location is in front of). + +Respawn NPC + Exclusive to pokefirered. The local id of the NPC the player will interact with when they white out. + Adding & Deleting Events ------------------------ diff --git a/docs/_sources/manual/editing-map-header.rst.txt b/docs/_sources/manual/editing-map-header.rst.txt index 1300450c..a5cd1569 100644 --- a/docs/_sources/manual/editing-map-header.rst.txt +++ b/docs/_sources/manual/editing-map-header.rst.txt @@ -22,7 +22,7 @@ Weather The weather that is running when entering the map. Type - The type of map. This value is used by various things in the game engine. For example, in Ruby Version, running shoes can only be used when the map type is ``MAP_TYPE_INDOOR``. + The type of map. This value is used by various things in the game engine. For example, in Ruby Version, running shoes cannot be used when the map type is ``MAP_TYPE_INDOOR``. Battle Scene Controls what graphics are used in battles. @@ -36,8 +36,11 @@ Allow Running Allow Biking Controls whether or not a bike can be used. -Allow Dig & Escape Rop +Allow Dig & Escape Rope Controls whether the Dig field move or the Escape Rope item can be used. +Floor Number + Exclusive to pokefirered. Used to append a number to the map name popup. Negative values are prefixed with "B" for basement, and floor 127 is "Rooftop". + Custom Fields You can enter custom fields if you need support for additional fields in your project. They can also be useful for keeping notes. diff --git a/docs/_sources/manual/editing-map-tiles.rst.txt b/docs/_sources/manual/editing-map-tiles.rst.txt index 3aeb2117..63672f8f 100644 --- a/docs/_sources/manual/editing-map-tiles.rst.txt +++ b/docs/_sources/manual/editing-map-tiles.rst.txt @@ -144,6 +144,8 @@ The map's border can be modified by painting on the Border image, which is locat Change Map Border +The dimensions of the map's border can also be adjusted for pokefirered projects via the ``Change Dimensions`` button. If you have modified your pokeemerald or pokeruby project to support custom border sizes you can enable this option with the ``use_custom_border_size`` field in your project's ``porymap.project.cfg`` file. + Change Map Tilesets ------------------- diff --git a/docs/_sources/manual/introduction.rst.txt b/docs/_sources/manual/introduction.rst.txt index 1638f51c..7ad845da 100644 --- a/docs/_sources/manual/introduction.rst.txt +++ b/docs/_sources/manual/introduction.rst.txt @@ -14,7 +14,7 @@ Porymap reads and writes files in the decompilation projects. It **does not** r Getting Started --------------- -Before using Porymap, you must have your decompilation project setup. Porymap currently supports `pokeemerald `_ and `pokeruby `_. See their respective ``INSTALL.md`` files to get setup, and make sure you can successfully compile the ROM. +Before using Porymap, you must have your decompilation project setup. Porymap supports the `pokeemerald `_, `pokeruby `_, and `pokefirered `_ decompilation projects. See their respective ``INSTALL.md`` files to get setup, and make sure you can successfully compile the ROM. When launching Porymap for the first time, you will be greeted with the following empty window: diff --git a/docs/_sources/manual/navigation.rst.txt b/docs/_sources/manual/navigation.rst.txt index de31a368..afade419 100644 --- a/docs/_sources/manual/navigation.rst.txt +++ b/docs/_sources/manual/navigation.rst.txt @@ -25,6 +25,8 @@ Sort by Area Sort by Layout Organizes by map layouts. Most layouts are only used by a single map, but layouts like the Pokemon Center are used by many maps. +Right-clicking on the folder name in any of the sort modes will bring up a dialog to create a new map in that folder. For more details, see: :ref:`Creating New Maps `. + The *Expand All* |expand-all-button| and *Collapse All* |collapse-all-button| buttons will expand or collapse all of the map folders. Type in the filter to show maps that contain the filter text. @@ -81,7 +83,7 @@ The Tileset Editor can be opened with *File -> Tileset Editor*. When the Tilese Region Map Editor ----------------- -The Region Map Editor can be opened with *File -> Region Map Editor*. This window will allow you to modify the look and layout of maps on the game's region map. You can also modify the city map images using the bottom two panes. +The Region Map Editor can be opened with *File -> Region Map Editor*. This window will allow you to modify the look and layout of maps on the game's region map. You can also modify the city map images using the bottom two panes. Currently the Region Map Editor is only available for pokeemerald and pokeruby projects. .. figure:: images/navigation/region-map-editor.png :alt: Region Map Editor diff --git a/docs/_sources/manual/project-files.rst.txt b/docs/_sources/manual/project-files.rst.txt index 5c4fb0fa..92201854 100644 --- a/docs/_sources/manual/project-files.rst.txt +++ b/docs/_sources/manual/project-files.rst.txt @@ -19,10 +19,10 @@ to a file, it probably is not a good idea to edit yourself unless otherwise note data/tilesets/graphics.inc, yes, yes, also edits palette and tile image files listed in this file data/tilesets/metatiles.inc, yes, yes, also edits metatile files listed in this file src/data/wild_encounters.json, yes, yes, - src/data/field_event_obj/event_object_graphics_info_pointers.h, yes, no, - src/data/field_event_obj/event_object_graphics_info.h, yes, no, - src/data/field_event_obj/event_object_pic_tables.h, yes, no, - src/data/field_event_obj/event_object_graphics.h, yes, no, + src/data/object_events/object_event_graphics_info_pointers.h, yes, no, + src/data/object_events/object_event_graphics_info.h, yes, no, + src/data/object_events/object_event_pic_tables.h, yes, no, + src/data/object_events/object_event_graphics.h, yes, no, src/data/graphics/pokemon.h, yes, no, for pokemon sprite icons src/data/heal_locations.h, yes, yes, src/data/region_map/region_map_entries.h, yes, yes, @@ -34,13 +34,13 @@ to a file, it probably is not a good idea to edit yourself unless otherwise note include/constants/heal_locations.h, no, yes, include/constants/pokemon.h, yes, no, reads min and max level constants include/constants/map_types.h, yes, no, - include/constants/secret_bases.h, yes, no, - include/constants/event_object_movement_constants.h, yes, no, - include/constants/bg_event_constants.h, yes, no, + include/constants/trainer_types.h, yes, no, + include/constants/secret_bases.h, yes, no, pokeemerald and pokeruby only + include/constants/event_object_movement.h, yes, no, + include/constants/event_bg.h, yes, no, include/constants/region_map_sections.h, yes, no, include/constants/metatile_labels.h, yes, yes, include/constants/metatile_behaviors.h, yes, no, - include/constants/bg_event_constants.h, yes, no, include/fieldmap.h, yes, no, reads tileset related constants diff --git a/docs/_sources/manual/region-map-editor.rst.txt b/docs/_sources/manual/region-map-editor.rst.txt index 24642d19..418812e3 100644 --- a/docs/_sources/manual/region-map-editor.rst.txt +++ b/docs/_sources/manual/region-map-editor.rst.txt @@ -5,6 +5,9 @@ The Region Map Editor This is where you edit the region map for your game. To open the region map editor, navigate to *Tools -> Region Map Editor* from porymap's main window. +.. note:: + The region map editor is currently only available for pokeemerald and pokeruby. + When you first open the region map editor, your window will look like this: .. figure:: images/region-map-editor/rme-new-window.png diff --git a/docs/_sources/reference/changelog.rst.txt b/docs/_sources/reference/changelog.rst.txt deleted file mode 100644 index 93ae2360..00000000 --- a/docs/_sources/reference/changelog.rst.txt +++ /dev/null @@ -1,3 +0,0 @@ -*********** -Changelog -*********** \ No newline at end of file diff --git a/docs/_static/ajax-loader.gif b/docs/_static/ajax-loader.gif deleted file mode 100644 index 61faf8ca..00000000 Binary files a/docs/_static/ajax-loader.gif and /dev/null differ diff --git a/docs/_static/comment-bright.png b/docs/_static/comment-bright.png deleted file mode 100644 index 15e27edb..00000000 Binary files a/docs/_static/comment-bright.png and /dev/null differ diff --git a/docs/_static/comment-close.png b/docs/_static/comment-close.png deleted file mode 100644 index 4d91bcf5..00000000 Binary files a/docs/_static/comment-close.png and /dev/null differ diff --git a/docs/_static/comment.png b/docs/_static/comment.png deleted file mode 100644 index dfbc0cbd..00000000 Binary files a/docs/_static/comment.png and /dev/null differ diff --git a/docs/_static/documentation_options.js b/docs/_static/documentation_options.js index 4790c4d3..2fa8c97f 100644 --- a/docs/_static/documentation_options.js +++ b/docs/_static/documentation_options.js @@ -5,6 +5,7 @@ var DOCUMENTATION_OPTIONS = { COLLAPSE_INDEX: false, BUILDER: 'html', FILE_SUFFIX: '.html', + LINK_SUFFIX: '.html', HAS_SOURCE: true, SOURCELINK_SUFFIX: '.txt', NAVIGATION_WITH_KEYS: false diff --git a/docs/_static/down-pressed.png b/docs/_static/down-pressed.png deleted file mode 100644 index 5756c8ca..00000000 Binary files a/docs/_static/down-pressed.png and /dev/null differ diff --git a/docs/_static/down.png b/docs/_static/down.png deleted file mode 100644 index 1b3bdad2..00000000 Binary files a/docs/_static/down.png and /dev/null differ diff --git a/docs/_static/jquery-3.2.1.js b/docs/_static/jquery-3.2.1.js deleted file mode 100644 index d2d8ca47..00000000 --- a/docs/_static/jquery-3.2.1.js +++ /dev/null @@ -1,10253 +0,0 @@ -/*! - * jQuery JavaScript Library v3.2.1 - * https://jquery.com/ - * - * Includes Sizzle.js - * https://sizzlejs.com/ - * - * Copyright JS Foundation and other contributors - * Released under the MIT license - * https://jquery.org/license - * - * Date: 2017-03-20T18:59Z - */ -( function( global, factory ) { - - "use strict"; - - if ( typeof module === "object" && typeof module.exports === "object" ) { - - // For CommonJS and CommonJS-like environments where a proper `window` - // is present, execute the factory and get jQuery. - // For environments that do not have a `window` with a `document` - // (such as Node.js), expose a factory as module.exports. - // This accentuates the need for the creation of a real `window`. - // e.g. var jQuery = require("jquery")(window); - // See ticket #14549 for more info. - module.exports = global.document ? - factory( global, true ) : - function( w ) { - if ( !w.document ) { - throw new Error( "jQuery requires a window with a document" ); - } - return factory( w ); - }; - } else { - factory( global ); - } - -// Pass this if window is not defined yet -} )( typeof window !== "undefined" ? window : this, function( window, noGlobal ) { - -// Edge <= 12 - 13+, Firefox <=18 - 45+, IE 10 - 11, Safari 5.1 - 9+, iOS 6 - 9.1 -// throw exceptions when non-strict code (e.g., ASP.NET 4.5) accesses strict mode -// arguments.callee.caller (trac-13335). But as of jQuery 3.0 (2016), strict mode should be common -// enough that all such attempts are guarded in a try block. -"use strict"; - -var arr = []; - -var document = window.document; - -var getProto = Object.getPrototypeOf; - -var slice = arr.slice; - -var concat = arr.concat; - -var push = arr.push; - -var indexOf = arr.indexOf; - -var class2type = {}; - -var toString = class2type.toString; - -var hasOwn = class2type.hasOwnProperty; - -var fnToString = hasOwn.toString; - -var ObjectFunctionString = fnToString.call( Object ); - -var support = {}; - - - - function DOMEval( code, doc ) { - doc = doc || document; - - var script = doc.createElement( "script" ); - - script.text = code; - doc.head.appendChild( script ).parentNode.removeChild( script ); - } -/* global Symbol */ -// Defining this global in .eslintrc.json would create a danger of using the global -// unguarded in another place, it seems safer to define global only for this module - - - -var - version = "3.2.1", - - // Define a local copy of jQuery - jQuery = function( selector, context ) { - - // The jQuery object is actually just the init constructor 'enhanced' - // Need init if jQuery is called (just allow error to be thrown if not included) - return new jQuery.fn.init( selector, context ); - }, - - // Support: Android <=4.0 only - // Make sure we trim BOM and NBSP - rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g, - - // Matches dashed string for camelizing - rmsPrefix = /^-ms-/, - rdashAlpha = /-([a-z])/g, - - // Used by jQuery.camelCase as callback to replace() - fcamelCase = function( all, letter ) { - return letter.toUpperCase(); - }; - -jQuery.fn = jQuery.prototype = { - - // The current version of jQuery being used - jquery: version, - - constructor: jQuery, - - // The default length of a jQuery object is 0 - length: 0, - - toArray: function() { - return slice.call( this ); - }, - - // Get the Nth element in the matched element set OR - // Get the whole matched element set as a clean array - get: function( num ) { - - // Return all the elements in a clean array - if ( num == null ) { - return slice.call( this ); - } - - // Return just the one element from the set - return num < 0 ? this[ num + this.length ] : this[ num ]; - }, - - // Take an array of elements and push it onto the stack - // (returning the new matched element set) - pushStack: function( elems ) { - - // Build a new jQuery matched element set - var ret = jQuery.merge( this.constructor(), elems ); - - // Add the old object onto the stack (as a reference) - ret.prevObject = this; - - // Return the newly-formed element set - return ret; - }, - - // Execute a callback for every element in the matched set. - each: function( callback ) { - return jQuery.each( this, callback ); - }, - - map: function( callback ) { - return this.pushStack( jQuery.map( this, function( elem, i ) { - return callback.call( elem, i, elem ); - } ) ); - }, - - slice: function() { - return this.pushStack( slice.apply( this, arguments ) ); - }, - - first: function() { - return this.eq( 0 ); - }, - - last: function() { - return this.eq( -1 ); - }, - - eq: function( i ) { - var len = this.length, - j = +i + ( i < 0 ? len : 0 ); - return this.pushStack( j >= 0 && j < len ? [ this[ j ] ] : [] ); - }, - - end: function() { - return this.prevObject || this.constructor(); - }, - - // For internal use only. - // Behaves like an Array's method, not like a jQuery method. - push: push, - sort: arr.sort, - splice: arr.splice -}; - -jQuery.extend = jQuery.fn.extend = function() { - var options, name, src, copy, copyIsArray, clone, - target = arguments[ 0 ] || {}, - i = 1, - length = arguments.length, - deep = false; - - // Handle a deep copy situation - if ( typeof target === "boolean" ) { - deep = target; - - // Skip the boolean and the target - target = arguments[ i ] || {}; - i++; - } - - // Handle case when target is a string or something (possible in deep copy) - if ( typeof target !== "object" && !jQuery.isFunction( target ) ) { - target = {}; - } - - // Extend jQuery itself if only one argument is passed - if ( i === length ) { - target = this; - i--; - } - - for ( ; i < length; i++ ) { - - // Only deal with non-null/undefined values - if ( ( options = arguments[ i ] ) != null ) { - - // Extend the base object - for ( name in options ) { - src = target[ name ]; - copy = options[ name ]; - - // Prevent never-ending loop - if ( target === copy ) { - continue; - } - - // Recurse if we're merging plain objects or arrays - if ( deep && copy && ( jQuery.isPlainObject( copy ) || - ( copyIsArray = Array.isArray( copy ) ) ) ) { - - if ( copyIsArray ) { - copyIsArray = false; - clone = src && Array.isArray( src ) ? src : []; - - } else { - clone = src && jQuery.isPlainObject( src ) ? src : {}; - } - - // Never move original objects, clone them - target[ name ] = jQuery.extend( deep, clone, copy ); - - // Don't bring in undefined values - } else if ( copy !== undefined ) { - target[ name ] = copy; - } - } - } - } - - // Return the modified object - return target; -}; - -jQuery.extend( { - - // Unique for each copy of jQuery on the page - expando: "jQuery" + ( version + Math.random() ).replace( /\D/g, "" ), - - // Assume jQuery is ready without the ready module - isReady: true, - - error: function( msg ) { - throw new Error( msg ); - }, - - noop: function() {}, - - isFunction: function( obj ) { - return jQuery.type( obj ) === "function"; - }, - - isWindow: function( obj ) { - return obj != null && obj === obj.window; - }, - - isNumeric: function( obj ) { - - // As of jQuery 3.0, isNumeric is limited to - // strings and numbers (primitives or objects) - // that can be coerced to finite numbers (gh-2662) - var type = jQuery.type( obj ); - return ( type === "number" || type === "string" ) && - - // parseFloat NaNs numeric-cast false positives ("") - // ...but misinterprets leading-number strings, particularly hex literals ("0x...") - // subtraction forces infinities to NaN - !isNaN( obj - parseFloat( obj ) ); - }, - - isPlainObject: function( obj ) { - var proto, Ctor; - - // Detect obvious negatives - // Use toString instead of jQuery.type to catch host objects - if ( !obj || toString.call( obj ) !== "[object Object]" ) { - return false; - } - - proto = getProto( obj ); - - // Objects with no prototype (e.g., `Object.create( null )`) are plain - if ( !proto ) { - return true; - } - - // Objects with prototype are plain iff they were constructed by a global Object function - Ctor = hasOwn.call( proto, "constructor" ) && proto.constructor; - return typeof Ctor === "function" && fnToString.call( Ctor ) === ObjectFunctionString; - }, - - isEmptyObject: function( obj ) { - - /* eslint-disable no-unused-vars */ - // See https://github.com/eslint/eslint/issues/6125 - var name; - - for ( name in obj ) { - return false; - } - return true; - }, - - type: function( obj ) { - if ( obj == null ) { - return obj + ""; - } - - // Support: Android <=2.3 only (functionish RegExp) - return typeof obj === "object" || typeof obj === "function" ? - class2type[ toString.call( obj ) ] || "object" : - typeof obj; - }, - - // Evaluates a script in a global context - globalEval: function( code ) { - DOMEval( code ); - }, - - // Convert dashed to camelCase; used by the css and data modules - // Support: IE <=9 - 11, Edge 12 - 13 - // Microsoft forgot to hump their vendor prefix (#9572) - camelCase: function( string ) { - return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase ); - }, - - each: function( obj, callback ) { - var length, i = 0; - - if ( isArrayLike( obj ) ) { - length = obj.length; - for ( ; i < length; i++ ) { - if ( callback.call( obj[ i ], i, obj[ i ] ) === false ) { - break; - } - } - } else { - for ( i in obj ) { - if ( callback.call( obj[ i ], i, obj[ i ] ) === false ) { - break; - } - } - } - - return obj; - }, - - // Support: Android <=4.0 only - trim: function( text ) { - return text == null ? - "" : - ( text + "" ).replace( rtrim, "" ); - }, - - // results is for internal usage only - makeArray: function( arr, results ) { - var ret = results || []; - - if ( arr != null ) { - if ( isArrayLike( Object( arr ) ) ) { - jQuery.merge( ret, - typeof arr === "string" ? - [ arr ] : arr - ); - } else { - push.call( ret, arr ); - } - } - - return ret; - }, - - inArray: function( elem, arr, i ) { - return arr == null ? -1 : indexOf.call( arr, elem, i ); - }, - - // Support: Android <=4.0 only, PhantomJS 1 only - // push.apply(_, arraylike) throws on ancient WebKit - merge: function( first, second ) { - var len = +second.length, - j = 0, - i = first.length; - - for ( ; j < len; j++ ) { - first[ i++ ] = second[ j ]; - } - - first.length = i; - - return first; - }, - - grep: function( elems, callback, invert ) { - var callbackInverse, - matches = [], - i = 0, - length = elems.length, - callbackExpect = !invert; - - // Go through the array, only saving the items - // that pass the validator function - for ( ; i < length; i++ ) { - callbackInverse = !callback( elems[ i ], i ); - if ( callbackInverse !== callbackExpect ) { - matches.push( elems[ i ] ); - } - } - - return matches; - }, - - // arg is for internal usage only - map: function( elems, callback, arg ) { - var length, value, - i = 0, - ret = []; - - // Go through the array, translating each of the items to their new values - if ( isArrayLike( elems ) ) { - length = elems.length; - for ( ; i < length; i++ ) { - value = callback( elems[ i ], i, arg ); - - if ( value != null ) { - ret.push( value ); - } - } - - // Go through every key on the object, - } else { - for ( i in elems ) { - value = callback( elems[ i ], i, arg ); - - if ( value != null ) { - ret.push( value ); - } - } - } - - // Flatten any nested arrays - return concat.apply( [], ret ); - }, - - // A global GUID counter for objects - guid: 1, - - // Bind a function to a context, optionally partially applying any - // arguments. - proxy: function( fn, context ) { - var tmp, args, proxy; - - if ( typeof context === "string" ) { - tmp = fn[ context ]; - context = fn; - fn = tmp; - } - - // Quick check to determine if target is callable, in the spec - // this throws a TypeError, but we will just return undefined. - if ( !jQuery.isFunction( fn ) ) { - return undefined; - } - - // Simulated bind - args = slice.call( arguments, 2 ); - proxy = function() { - return fn.apply( context || this, args.concat( slice.call( arguments ) ) ); - }; - - // Set the guid of unique handler to the same of original handler, so it can be removed - proxy.guid = fn.guid = fn.guid || jQuery.guid++; - - return proxy; - }, - - now: Date.now, - - // jQuery.support is not used in Core but other projects attach their - // properties to it so it needs to exist. - support: support -} ); - -if ( typeof Symbol === "function" ) { - jQuery.fn[ Symbol.iterator ] = arr[ Symbol.iterator ]; -} - -// Populate the class2type map -jQuery.each( "Boolean Number String Function Array Date RegExp Object Error Symbol".split( " " ), -function( i, name ) { - class2type[ "[object " + name + "]" ] = name.toLowerCase(); -} ); - -function isArrayLike( obj ) { - - // Support: real iOS 8.2 only (not reproducible in simulator) - // `in` check used to prevent JIT error (gh-2145) - // hasOwn isn't used here due to false negatives - // regarding Nodelist length in IE - var length = !!obj && "length" in obj && obj.length, - type = jQuery.type( obj ); - - if ( type === "function" || jQuery.isWindow( obj ) ) { - return false; - } - - return type === "array" || length === 0 || - typeof length === "number" && length > 0 && ( length - 1 ) in obj; -} -var Sizzle = -/*! - * Sizzle CSS Selector Engine v2.3.3 - * https://sizzlejs.com/ - * - * Copyright jQuery Foundation and other contributors - * Released under the MIT license - * http://jquery.org/license - * - * Date: 2016-08-08 - */ -(function( window ) { - -var i, - support, - Expr, - getText, - isXML, - tokenize, - compile, - select, - outermostContext, - sortInput, - hasDuplicate, - - // Local document vars - setDocument, - document, - docElem, - documentIsHTML, - rbuggyQSA, - rbuggyMatches, - matches, - contains, - - // Instance-specific data - expando = "sizzle" + 1 * new Date(), - preferredDoc = window.document, - dirruns = 0, - done = 0, - classCache = createCache(), - tokenCache = createCache(), - compilerCache = createCache(), - sortOrder = function( a, b ) { - if ( a === b ) { - hasDuplicate = true; - } - return 0; - }, - - // Instance methods - hasOwn = ({}).hasOwnProperty, - arr = [], - pop = arr.pop, - push_native = arr.push, - push = arr.push, - slice = arr.slice, - // Use a stripped-down indexOf as it's faster than native - // https://jsperf.com/thor-indexof-vs-for/5 - indexOf = function( list, elem ) { - var i = 0, - len = list.length; - for ( ; i < len; i++ ) { - if ( list[i] === elem ) { - return i; - } - } - return -1; - }, - - booleans = "checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped", - - // Regular expressions - - // http://www.w3.org/TR/css3-selectors/#whitespace - whitespace = "[\\x20\\t\\r\\n\\f]", - - // http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier - identifier = "(?:\\\\.|[\\w-]|[^\0-\\xa0])+", - - // Attribute selectors: http://www.w3.org/TR/selectors/#attribute-selectors - attributes = "\\[" + whitespace + "*(" + identifier + ")(?:" + whitespace + - // Operator (capture 2) - "*([*^$|!~]?=)" + whitespace + - // "Attribute values must be CSS identifiers [capture 5] or strings [capture 3 or capture 4]" - "*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|(" + identifier + "))|)" + whitespace + - "*\\]", - - pseudos = ":(" + identifier + ")(?:\\((" + - // To reduce the number of selectors needing tokenize in the preFilter, prefer arguments: - // 1. quoted (capture 3; capture 4 or capture 5) - "('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|" + - // 2. simple (capture 6) - "((?:\\\\.|[^\\\\()[\\]]|" + attributes + ")*)|" + - // 3. anything else (capture 2) - ".*" + - ")\\)|)", - - // Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter - rwhitespace = new RegExp( whitespace + "+", "g" ), - rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ), - - rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ), - rcombinators = new RegExp( "^" + whitespace + "*([>+~]|" + whitespace + ")" + whitespace + "*" ), - - rattributeQuotes = new RegExp( "=" + whitespace + "*([^\\]'\"]*?)" + whitespace + "*\\]", "g" ), - - rpseudo = new RegExp( pseudos ), - ridentifier = new RegExp( "^" + identifier + "$" ), - - matchExpr = { - "ID": new RegExp( "^#(" + identifier + ")" ), - "CLASS": new RegExp( "^\\.(" + identifier + ")" ), - "TAG": new RegExp( "^(" + identifier + "|[*])" ), - "ATTR": new RegExp( "^" + attributes ), - "PSEUDO": new RegExp( "^" + pseudos ), - "CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace + - "*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace + - "*(\\d+)|))" + whitespace + "*\\)|)", "i" ), - "bool": new RegExp( "^(?:" + booleans + ")$", "i" ), - // For use in libraries implementing .is() - // We use this for POS matching in `select` - "needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" + - whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" ) - }, - - rinputs = /^(?:input|select|textarea|button)$/i, - rheader = /^h\d$/i, - - rnative = /^[^{]+\{\s*\[native \w/, - - // Easily-parseable/retrievable ID or TAG or CLASS selectors - rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/, - - rsibling = /[+~]/, - - // CSS escapes - // http://www.w3.org/TR/CSS21/syndata.html#escaped-characters - runescape = new RegExp( "\\\\([\\da-f]{1,6}" + whitespace + "?|(" + whitespace + ")|.)", "ig" ), - funescape = function( _, escaped, escapedWhitespace ) { - var high = "0x" + escaped - 0x10000; - // NaN means non-codepoint - // Support: Firefox<24 - // Workaround erroneous numeric interpretation of +"0x" - return high !== high || escapedWhitespace ? - escaped : - high < 0 ? - // BMP codepoint - String.fromCharCode( high + 0x10000 ) : - // Supplemental Plane codepoint (surrogate pair) - String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 ); - }, - - // CSS string/identifier serialization - // https://drafts.csswg.org/cssom/#common-serializing-idioms - rcssescape = /([\0-\x1f\x7f]|^-?\d)|^-$|[^\0-\x1f\x7f-\uFFFF\w-]/g, - fcssescape = function( ch, asCodePoint ) { - if ( asCodePoint ) { - - // U+0000 NULL becomes U+FFFD REPLACEMENT CHARACTER - if ( ch === "\0" ) { - return "\uFFFD"; - } - - // Control characters and (dependent upon position) numbers get escaped as code points - return ch.slice( 0, -1 ) + "\\" + ch.charCodeAt( ch.length - 1 ).toString( 16 ) + " "; - } - - // Other potentially-special ASCII characters get backslash-escaped - return "\\" + ch; - }, - - // Used for iframes - // See setDocument() - // Removing the function wrapper causes a "Permission Denied" - // error in IE - unloadHandler = function() { - setDocument(); - }, - - disabledAncestor = addCombinator( - function( elem ) { - return elem.disabled === true && ("form" in elem || "label" in elem); - }, - { dir: "parentNode", next: "legend" } - ); - -// Optimize for push.apply( _, NodeList ) -try { - push.apply( - (arr = slice.call( preferredDoc.childNodes )), - preferredDoc.childNodes - ); - // Support: Android<4.0 - // Detect silently failing push.apply - arr[ preferredDoc.childNodes.length ].nodeType; -} catch ( e ) { - push = { apply: arr.length ? - - // Leverage slice if possible - function( target, els ) { - push_native.apply( target, slice.call(els) ); - } : - - // Support: IE<9 - // Otherwise append directly - function( target, els ) { - var j = target.length, - i = 0; - // Can't trust NodeList.length - while ( (target[j++] = els[i++]) ) {} - target.length = j - 1; - } - }; -} - -function Sizzle( selector, context, results, seed ) { - var m, i, elem, nid, match, groups, newSelector, - newContext = context && context.ownerDocument, - - // nodeType defaults to 9, since context defaults to document - nodeType = context ? context.nodeType : 9; - - results = results || []; - - // Return early from calls with invalid selector or context - if ( typeof selector !== "string" || !selector || - nodeType !== 1 && nodeType !== 9 && nodeType !== 11 ) { - - return results; - } - - // Try to shortcut find operations (as opposed to filters) in HTML documents - if ( !seed ) { - - if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) { - setDocument( context ); - } - context = context || document; - - if ( documentIsHTML ) { - - // If the selector is sufficiently simple, try using a "get*By*" DOM method - // (excepting DocumentFragment context, where the methods don't exist) - if ( nodeType !== 11 && (match = rquickExpr.exec( selector )) ) { - - // ID selector - if ( (m = match[1]) ) { - - // Document context - if ( nodeType === 9 ) { - if ( (elem = context.getElementById( m )) ) { - - // Support: IE, Opera, Webkit - // TODO: identify versions - // getElementById can match elements by name instead of ID - if ( elem.id === m ) { - results.push( elem ); - return results; - } - } else { - return results; - } - - // Element context - } else { - - // Support: IE, Opera, Webkit - // TODO: identify versions - // getElementById can match elements by name instead of ID - if ( newContext && (elem = newContext.getElementById( m )) && - contains( context, elem ) && - elem.id === m ) { - - results.push( elem ); - return results; - } - } - - // Type selector - } else if ( match[2] ) { - push.apply( results, context.getElementsByTagName( selector ) ); - return results; - - // Class selector - } else if ( (m = match[3]) && support.getElementsByClassName && - context.getElementsByClassName ) { - - push.apply( results, context.getElementsByClassName( m ) ); - return results; - } - } - - // Take advantage of querySelectorAll - if ( support.qsa && - !compilerCache[ selector + " " ] && - (!rbuggyQSA || !rbuggyQSA.test( selector )) ) { - - if ( nodeType !== 1 ) { - newContext = context; - newSelector = selector; - - // qSA looks outside Element context, which is not what we want - // Thanks to Andrew Dupont for this workaround technique - // Support: IE <=8 - // Exclude object elements - } else if ( context.nodeName.toLowerCase() !== "object" ) { - - // Capture the context ID, setting it first if necessary - if ( (nid = context.getAttribute( "id" )) ) { - nid = nid.replace( rcssescape, fcssescape ); - } else { - context.setAttribute( "id", (nid = expando) ); - } - - // Prefix every selector in the list - groups = tokenize( selector ); - i = groups.length; - while ( i-- ) { - groups[i] = "#" + nid + " " + toSelector( groups[i] ); - } - newSelector = groups.join( "," ); - - // Expand context for sibling selectors - newContext = rsibling.test( selector ) && testContext( context.parentNode ) || - context; - } - - if ( newSelector ) { - try { - push.apply( results, - newContext.querySelectorAll( newSelector ) - ); - return results; - } catch ( qsaError ) { - } finally { - if ( nid === expando ) { - context.removeAttribute( "id" ); - } - } - } - } - } - } - - // All others - return select( selector.replace( rtrim, "$1" ), context, results, seed ); -} - -/** - * Create key-value caches of limited size - * @returns {function(string, object)} Returns the Object data after storing it on itself with - * property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength) - * deleting the oldest entry - */ -function createCache() { - var keys = []; - - function cache( key, value ) { - // Use (key + " ") to avoid collision with native prototype properties (see Issue #157) - if ( keys.push( key + " " ) > Expr.cacheLength ) { - // Only keep the most recent entries - delete cache[ keys.shift() ]; - } - return (cache[ key + " " ] = value); - } - return cache; -} - -/** - * Mark a function for special use by Sizzle - * @param {Function} fn The function to mark - */ -function markFunction( fn ) { - fn[ expando ] = true; - return fn; -} - -/** - * Support testing using an element - * @param {Function} fn Passed the created element and returns a boolean result - */ -function assert( fn ) { - var el = document.createElement("fieldset"); - - try { - return !!fn( el ); - } catch (e) { - return false; - } finally { - // Remove from its parent by default - if ( el.parentNode ) { - el.parentNode.removeChild( el ); - } - // release memory in IE - el = null; - } -} - -/** - * Adds the same handler for all of the specified attrs - * @param {String} attrs Pipe-separated list of attributes - * @param {Function} handler The method that will be applied - */ -function addHandle( attrs, handler ) { - var arr = attrs.split("|"), - i = arr.length; - - while ( i-- ) { - Expr.attrHandle[ arr[i] ] = handler; - } -} - -/** - * Checks document order of two siblings - * @param {Element} a - * @param {Element} b - * @returns {Number} Returns less than 0 if a precedes b, greater than 0 if a follows b - */ -function siblingCheck( a, b ) { - var cur = b && a, - diff = cur && a.nodeType === 1 && b.nodeType === 1 && - a.sourceIndex - b.sourceIndex; - - // Use IE sourceIndex if available on both nodes - if ( diff ) { - return diff; - } - - // Check if b follows a - if ( cur ) { - while ( (cur = cur.nextSibling) ) { - if ( cur === b ) { - return -1; - } - } - } - - return a ? 1 : -1; -} - -/** - * Returns a function to use in pseudos for input types - * @param {String} type - */ -function createInputPseudo( type ) { - return function( elem ) { - var name = elem.nodeName.toLowerCase(); - return name === "input" && elem.type === type; - }; -} - -/** - * Returns a function to use in pseudos for buttons - * @param {String} type - */ -function createButtonPseudo( type ) { - return function( elem ) { - var name = elem.nodeName.toLowerCase(); - return (name === "input" || name === "button") && elem.type === type; - }; -} - -/** - * Returns a function to use in pseudos for :enabled/:disabled - * @param {Boolean} disabled true for :disabled; false for :enabled - */ -function createDisabledPseudo( disabled ) { - - // Known :disabled false positives: fieldset[disabled] > legend:nth-of-type(n+2) :can-disable - return function( elem ) { - - // Only certain elements can match :enabled or :disabled - // https://html.spec.whatwg.org/multipage/scripting.html#selector-enabled - // https://html.spec.whatwg.org/multipage/scripting.html#selector-disabled - if ( "form" in elem ) { - - // Check for inherited disabledness on relevant non-disabled elements: - // * listed form-associated elements in a disabled fieldset - // https://html.spec.whatwg.org/multipage/forms.html#category-listed - // https://html.spec.whatwg.org/multipage/forms.html#concept-fe-disabled - // * option elements in a disabled optgroup - // https://html.spec.whatwg.org/multipage/forms.html#concept-option-disabled - // All such elements have a "form" property. - if ( elem.parentNode && elem.disabled === false ) { - - // Option elements defer to a parent optgroup if present - if ( "label" in elem ) { - if ( "label" in elem.parentNode ) { - return elem.parentNode.disabled === disabled; - } else { - return elem.disabled === disabled; - } - } - - // Support: IE 6 - 11 - // Use the isDisabled shortcut property to check for disabled fieldset ancestors - return elem.isDisabled === disabled || - - // Where there is no isDisabled, check manually - /* jshint -W018 */ - elem.isDisabled !== !disabled && - disabledAncestor( elem ) === disabled; - } - - return elem.disabled === disabled; - - // Try to winnow out elements that can't be disabled before trusting the disabled property. - // Some victims get caught in our net (label, legend, menu, track), but it shouldn't - // even exist on them, let alone have a boolean value. - } else if ( "label" in elem ) { - return elem.disabled === disabled; - } - - // Remaining elements are neither :enabled nor :disabled - return false; - }; -} - -/** - * Returns a function to use in pseudos for positionals - * @param {Function} fn - */ -function createPositionalPseudo( fn ) { - return markFunction(function( argument ) { - argument = +argument; - return markFunction(function( seed, matches ) { - var j, - matchIndexes = fn( [], seed.length, argument ), - i = matchIndexes.length; - - // Match elements found at the specified indexes - while ( i-- ) { - if ( seed[ (j = matchIndexes[i]) ] ) { - seed[j] = !(matches[j] = seed[j]); - } - } - }); - }); -} - -/** - * Checks a node for validity as a Sizzle context - * @param {Element|Object=} context - * @returns {Element|Object|Boolean} The input node if acceptable, otherwise a falsy value - */ -function testContext( context ) { - return context && typeof context.getElementsByTagName !== "undefined" && context; -} - -// Expose support vars for convenience -support = Sizzle.support = {}; - -/** - * Detects XML nodes - * @param {Element|Object} elem An element or a document - * @returns {Boolean} True iff elem is a non-HTML XML node - */ -isXML = Sizzle.isXML = function( elem ) { - // documentElement is verified for cases where it doesn't yet exist - // (such as loading iframes in IE - #4833) - var documentElement = elem && (elem.ownerDocument || elem).documentElement; - return documentElement ? documentElement.nodeName !== "HTML" : false; -}; - -/** - * Sets document-related variables once based on the current document - * @param {Element|Object} [doc] An element or document object to use to set the document - * @returns {Object} Returns the current document - */ -setDocument = Sizzle.setDocument = function( node ) { - var hasCompare, subWindow, - doc = node ? node.ownerDocument || node : preferredDoc; - - // Return early if doc is invalid or already selected - if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) { - return document; - } - - // Update global variables - document = doc; - docElem = document.documentElement; - documentIsHTML = !isXML( document ); - - // Support: IE 9-11, Edge - // Accessing iframe documents after unload throws "permission denied" errors (jQuery #13936) - if ( preferredDoc !== document && - (subWindow = document.defaultView) && subWindow.top !== subWindow ) { - - // Support: IE 11, Edge - if ( subWindow.addEventListener ) { - subWindow.addEventListener( "unload", unloadHandler, false ); - - // Support: IE 9 - 10 only - } else if ( subWindow.attachEvent ) { - subWindow.attachEvent( "onunload", unloadHandler ); - } - } - - /* Attributes - ---------------------------------------------------------------------- */ - - // Support: IE<8 - // Verify that getAttribute really returns attributes and not properties - // (excepting IE8 booleans) - support.attributes = assert(function( el ) { - el.className = "i"; - return !el.getAttribute("className"); - }); - - /* getElement(s)By* - ---------------------------------------------------------------------- */ - - // Check if getElementsByTagName("*") returns only elements - support.getElementsByTagName = assert(function( el ) { - el.appendChild( document.createComment("") ); - return !el.getElementsByTagName("*").length; - }); - - // Support: IE<9 - support.getElementsByClassName = rnative.test( document.getElementsByClassName ); - - // Support: IE<10 - // Check if getElementById returns elements by name - // The broken getElementById methods don't pick up programmatically-set names, - // so use a roundabout getElementsByName test - support.getById = assert(function( el ) { - docElem.appendChild( el ).id = expando; - return !document.getElementsByName || !document.getElementsByName( expando ).length; - }); - - // ID filter and find - if ( support.getById ) { - Expr.filter["ID"] = function( id ) { - var attrId = id.replace( runescape, funescape ); - return function( elem ) { - return elem.getAttribute("id") === attrId; - }; - }; - Expr.find["ID"] = function( id, context ) { - if ( typeof context.getElementById !== "undefined" && documentIsHTML ) { - var elem = context.getElementById( id ); - return elem ? [ elem ] : []; - } - }; - } else { - Expr.filter["ID"] = function( id ) { - var attrId = id.replace( runescape, funescape ); - return function( elem ) { - var node = typeof elem.getAttributeNode !== "undefined" && - elem.getAttributeNode("id"); - return node && node.value === attrId; - }; - }; - - // Support: IE 6 - 7 only - // getElementById is not reliable as a find shortcut - Expr.find["ID"] = function( id, context ) { - if ( typeof context.getElementById !== "undefined" && documentIsHTML ) { - var node, i, elems, - elem = context.getElementById( id ); - - if ( elem ) { - - // Verify the id attribute - node = elem.getAttributeNode("id"); - if ( node && node.value === id ) { - return [ elem ]; - } - - // Fall back on getElementsByName - elems = context.getElementsByName( id ); - i = 0; - while ( (elem = elems[i++]) ) { - node = elem.getAttributeNode("id"); - if ( node && node.value === id ) { - return [ elem ]; - } - } - } - - return []; - } - }; - } - - // Tag - Expr.find["TAG"] = support.getElementsByTagName ? - function( tag, context ) { - if ( typeof context.getElementsByTagName !== "undefined" ) { - return context.getElementsByTagName( tag ); - - // DocumentFragment nodes don't have gEBTN - } else if ( support.qsa ) { - return context.querySelectorAll( tag ); - } - } : - - function( tag, context ) { - var elem, - tmp = [], - i = 0, - // By happy coincidence, a (broken) gEBTN appears on DocumentFragment nodes too - results = context.getElementsByTagName( tag ); - - // Filter out possible comments - if ( tag === "*" ) { - while ( (elem = results[i++]) ) { - if ( elem.nodeType === 1 ) { - tmp.push( elem ); - } - } - - return tmp; - } - return results; - }; - - // Class - Expr.find["CLASS"] = support.getElementsByClassName && function( className, context ) { - if ( typeof context.getElementsByClassName !== "undefined" && documentIsHTML ) { - return context.getElementsByClassName( className ); - } - }; - - /* QSA/matchesSelector - ---------------------------------------------------------------------- */ - - // QSA and matchesSelector support - - // matchesSelector(:active) reports false when true (IE9/Opera 11.5) - rbuggyMatches = []; - - // qSa(:focus) reports false when true (Chrome 21) - // We allow this because of a bug in IE8/9 that throws an error - // whenever `document.activeElement` is accessed on an iframe - // So, we allow :focus to pass through QSA all the time to avoid the IE error - // See https://bugs.jquery.com/ticket/13378 - rbuggyQSA = []; - - if ( (support.qsa = rnative.test( document.querySelectorAll )) ) { - // Build QSA regex - // Regex strategy adopted from Diego Perini - assert(function( el ) { - // Select is set to empty string on purpose - // This is to test IE's treatment of not explicitly - // setting a boolean content attribute, - // since its presence should be enough - // https://bugs.jquery.com/ticket/12359 - docElem.appendChild( el ).innerHTML = "" + - ""; - - // Support: IE8, Opera 11-12.16 - // Nothing should be selected when empty strings follow ^= or $= or *= - // The test attribute must be unknown in Opera but "safe" for WinRT - // https://msdn.microsoft.com/en-us/library/ie/hh465388.aspx#attribute_section - if ( el.querySelectorAll("[msallowcapture^='']").length ) { - rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:''|\"\")" ); - } - - // Support: IE8 - // Boolean attributes and "value" are not treated correctly - if ( !el.querySelectorAll("[selected]").length ) { - rbuggyQSA.push( "\\[" + whitespace + "*(?:value|" + booleans + ")" ); - } - - // Support: Chrome<29, Android<4.4, Safari<7.0+, iOS<7.0+, PhantomJS<1.9.8+ - if ( !el.querySelectorAll( "[id~=" + expando + "-]" ).length ) { - rbuggyQSA.push("~="); - } - - // Webkit/Opera - :checked should return selected option elements - // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked - // IE8 throws error here and will not see later tests - if ( !el.querySelectorAll(":checked").length ) { - rbuggyQSA.push(":checked"); - } - - // Support: Safari 8+, iOS 8+ - // https://bugs.webkit.org/show_bug.cgi?id=136851 - // In-page `selector#id sibling-combinator selector` fails - if ( !el.querySelectorAll( "a#" + expando + "+*" ).length ) { - rbuggyQSA.push(".#.+[+~]"); - } - }); - - assert(function( el ) { - el.innerHTML = "" + - ""; - - // Support: Windows 8 Native Apps - // The type and name attributes are restricted during .innerHTML assignment - var input = document.createElement("input"); - input.setAttribute( "type", "hidden" ); - el.appendChild( input ).setAttribute( "name", "D" ); - - // Support: IE8 - // Enforce case-sensitivity of name attribute - if ( el.querySelectorAll("[name=d]").length ) { - rbuggyQSA.push( "name" + whitespace + "*[*^$|!~]?=" ); - } - - // FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled) - // IE8 throws error here and will not see later tests - if ( el.querySelectorAll(":enabled").length !== 2 ) { - rbuggyQSA.push( ":enabled", ":disabled" ); - } - - // Support: IE9-11+ - // IE's :disabled selector does not pick up the children of disabled fieldsets - docElem.appendChild( el ).disabled = true; - if ( el.querySelectorAll(":disabled").length !== 2 ) { - rbuggyQSA.push( ":enabled", ":disabled" ); - } - - // Opera 10-11 does not throw on post-comma invalid pseudos - el.querySelectorAll("*,:x"); - rbuggyQSA.push(",.*:"); - }); - } - - if ( (support.matchesSelector = rnative.test( (matches = docElem.matches || - docElem.webkitMatchesSelector || - docElem.mozMatchesSelector || - docElem.oMatchesSelector || - docElem.msMatchesSelector) )) ) { - - assert(function( el ) { - // Check to see if it's possible to do matchesSelector - // on a disconnected node (IE 9) - support.disconnectedMatch = matches.call( el, "*" ); - - // This should fail with an exception - // Gecko does not error, returns false instead - matches.call( el, "[s!='']:x" ); - rbuggyMatches.push( "!=", pseudos ); - }); - } - - rbuggyQSA = rbuggyQSA.length && new RegExp( rbuggyQSA.join("|") ); - rbuggyMatches = rbuggyMatches.length && new RegExp( rbuggyMatches.join("|") ); - - /* Contains - ---------------------------------------------------------------------- */ - hasCompare = rnative.test( docElem.compareDocumentPosition ); - - // Element contains another - // Purposefully self-exclusive - // As in, an element does not contain itself - contains = hasCompare || rnative.test( docElem.contains ) ? - function( a, b ) { - var adown = a.nodeType === 9 ? a.documentElement : a, - bup = b && b.parentNode; - return a === bup || !!( bup && bup.nodeType === 1 && ( - adown.contains ? - adown.contains( bup ) : - a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16 - )); - } : - function( a, b ) { - if ( b ) { - while ( (b = b.parentNode) ) { - if ( b === a ) { - return true; - } - } - } - return false; - }; - - /* Sorting - ---------------------------------------------------------------------- */ - - // Document order sorting - sortOrder = hasCompare ? - function( a, b ) { - - // Flag for duplicate removal - if ( a === b ) { - hasDuplicate = true; - return 0; - } - - // Sort on method existence if only one input has compareDocumentPosition - var compare = !a.compareDocumentPosition - !b.compareDocumentPosition; - if ( compare ) { - return compare; - } - - // Calculate position if both inputs belong to the same document - compare = ( a.ownerDocument || a ) === ( b.ownerDocument || b ) ? - a.compareDocumentPosition( b ) : - - // Otherwise we know they are disconnected - 1; - - // Disconnected nodes - if ( compare & 1 || - (!support.sortDetached && b.compareDocumentPosition( a ) === compare) ) { - - // Choose the first element that is related to our preferred document - if ( a === document || a.ownerDocument === preferredDoc && contains(preferredDoc, a) ) { - return -1; - } - if ( b === document || b.ownerDocument === preferredDoc && contains(preferredDoc, b) ) { - return 1; - } - - // Maintain original order - return sortInput ? - ( indexOf( sortInput, a ) - indexOf( sortInput, b ) ) : - 0; - } - - return compare & 4 ? -1 : 1; - } : - function( a, b ) { - // Exit early if the nodes are identical - if ( a === b ) { - hasDuplicate = true; - return 0; - } - - var cur, - i = 0, - aup = a.parentNode, - bup = b.parentNode, - ap = [ a ], - bp = [ b ]; - - // Parentless nodes are either documents or disconnected - if ( !aup || !bup ) { - return a === document ? -1 : - b === document ? 1 : - aup ? -1 : - bup ? 1 : - sortInput ? - ( indexOf( sortInput, a ) - indexOf( sortInput, b ) ) : - 0; - - // If the nodes are siblings, we can do a quick check - } else if ( aup === bup ) { - return siblingCheck( a, b ); - } - - // Otherwise we need full lists of their ancestors for comparison - cur = a; - while ( (cur = cur.parentNode) ) { - ap.unshift( cur ); - } - cur = b; - while ( (cur = cur.parentNode) ) { - bp.unshift( cur ); - } - - // Walk down the tree looking for a discrepancy - while ( ap[i] === bp[i] ) { - i++; - } - - return i ? - // Do a sibling check if the nodes have a common ancestor - siblingCheck( ap[i], bp[i] ) : - - // Otherwise nodes in our document sort first - ap[i] === preferredDoc ? -1 : - bp[i] === preferredDoc ? 1 : - 0; - }; - - return document; -}; - -Sizzle.matches = function( expr, elements ) { - return Sizzle( expr, null, null, elements ); -}; - -Sizzle.matchesSelector = function( elem, expr ) { - // Set document vars if needed - if ( ( elem.ownerDocument || elem ) !== document ) { - setDocument( elem ); - } - - // Make sure that attribute selectors are quoted - expr = expr.replace( rattributeQuotes, "='$1']" ); - - if ( support.matchesSelector && documentIsHTML && - !compilerCache[ expr + " " ] && - ( !rbuggyMatches || !rbuggyMatches.test( expr ) ) && - ( !rbuggyQSA || !rbuggyQSA.test( expr ) ) ) { - - try { - var ret = matches.call( elem, expr ); - - // IE 9's matchesSelector returns false on disconnected nodes - if ( ret || support.disconnectedMatch || - // As well, disconnected nodes are said to be in a document - // fragment in IE 9 - elem.document && elem.document.nodeType !== 11 ) { - return ret; - } - } catch (e) {} - } - - return Sizzle( expr, document, null, [ elem ] ).length > 0; -}; - -Sizzle.contains = function( context, elem ) { - // Set document vars if needed - if ( ( context.ownerDocument || context ) !== document ) { - setDocument( context ); - } - return contains( context, elem ); -}; - -Sizzle.attr = function( elem, name ) { - // Set document vars if needed - if ( ( elem.ownerDocument || elem ) !== document ) { - setDocument( elem ); - } - - var fn = Expr.attrHandle[ name.toLowerCase() ], - // Don't get fooled by Object.prototype properties (jQuery #13807) - val = fn && hasOwn.call( Expr.attrHandle, name.toLowerCase() ) ? - fn( elem, name, !documentIsHTML ) : - undefined; - - return val !== undefined ? - val : - support.attributes || !documentIsHTML ? - elem.getAttribute( name ) : - (val = elem.getAttributeNode(name)) && val.specified ? - val.value : - null; -}; - -Sizzle.escape = function( sel ) { - return (sel + "").replace( rcssescape, fcssescape ); -}; - -Sizzle.error = function( msg ) { - throw new Error( "Syntax error, unrecognized expression: " + msg ); -}; - -/** - * Document sorting and removing duplicates - * @param {ArrayLike} results - */ -Sizzle.uniqueSort = function( results ) { - var elem, - duplicates = [], - j = 0, - i = 0; - - // Unless we *know* we can detect duplicates, assume their presence - hasDuplicate = !support.detectDuplicates; - sortInput = !support.sortStable && results.slice( 0 ); - results.sort( sortOrder ); - - if ( hasDuplicate ) { - while ( (elem = results[i++]) ) { - if ( elem === results[ i ] ) { - j = duplicates.push( i ); - } - } - while ( j-- ) { - results.splice( duplicates[ j ], 1 ); - } - } - - // Clear input after sorting to release objects - // See https://github.com/jquery/sizzle/pull/225 - sortInput = null; - - return results; -}; - -/** - * Utility function for retrieving the text value of an array of DOM nodes - * @param {Array|Element} elem - */ -getText = Sizzle.getText = function( elem ) { - var node, - ret = "", - i = 0, - nodeType = elem.nodeType; - - if ( !nodeType ) { - // If no nodeType, this is expected to be an array - while ( (node = elem[i++]) ) { - // Do not traverse comment nodes - ret += getText( node ); - } - } else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) { - // Use textContent for elements - // innerText usage removed for consistency of new lines (jQuery #11153) - if ( typeof elem.textContent === "string" ) { - return elem.textContent; - } else { - // Traverse its children - for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { - ret += getText( elem ); - } - } - } else if ( nodeType === 3 || nodeType === 4 ) { - return elem.nodeValue; - } - // Do not include comment or processing instruction nodes - - return ret; -}; - -Expr = Sizzle.selectors = { - - // Can be adjusted by the user - cacheLength: 50, - - createPseudo: markFunction, - - match: matchExpr, - - attrHandle: {}, - - find: {}, - - relative: { - ">": { dir: "parentNode", first: true }, - " ": { dir: "parentNode" }, - "+": { dir: "previousSibling", first: true }, - "~": { dir: "previousSibling" } - }, - - preFilter: { - "ATTR": function( match ) { - match[1] = match[1].replace( runescape, funescape ); - - // Move the given value to match[3] whether quoted or unquoted - match[3] = ( match[3] || match[4] || match[5] || "" ).replace( runescape, funescape ); - - if ( match[2] === "~=" ) { - match[3] = " " + match[3] + " "; - } - - return match.slice( 0, 4 ); - }, - - "CHILD": function( match ) { - /* matches from matchExpr["CHILD"] - 1 type (only|nth|...) - 2 what (child|of-type) - 3 argument (even|odd|\d*|\d*n([+-]\d+)?|...) - 4 xn-component of xn+y argument ([+-]?\d*n|) - 5 sign of xn-component - 6 x of xn-component - 7 sign of y-component - 8 y of y-component - */ - match[1] = match[1].toLowerCase(); - - if ( match[1].slice( 0, 3 ) === "nth" ) { - // nth-* requires argument - if ( !match[3] ) { - Sizzle.error( match[0] ); - } - - // numeric x and y parameters for Expr.filter.CHILD - // remember that false/true cast respectively to 0/1 - match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) ); - match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" ); - - // other types prohibit arguments - } else if ( match[3] ) { - Sizzle.error( match[0] ); - } - - return match; - }, - - "PSEUDO": function( match ) { - var excess, - unquoted = !match[6] && match[2]; - - if ( matchExpr["CHILD"].test( match[0] ) ) { - return null; - } - - // Accept quoted arguments as-is - if ( match[3] ) { - match[2] = match[4] || match[5] || ""; - - // Strip excess characters from unquoted arguments - } else if ( unquoted && rpseudo.test( unquoted ) && - // Get excess from tokenize (recursively) - (excess = tokenize( unquoted, true )) && - // advance to the next closing parenthesis - (excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) { - - // excess is a negative index - match[0] = match[0].slice( 0, excess ); - match[2] = unquoted.slice( 0, excess ); - } - - // Return only captures needed by the pseudo filter method (type and argument) - return match.slice( 0, 3 ); - } - }, - - filter: { - - "TAG": function( nodeNameSelector ) { - var nodeName = nodeNameSelector.replace( runescape, funescape ).toLowerCase(); - return nodeNameSelector === "*" ? - function() { return true; } : - function( elem ) { - return elem.nodeName && elem.nodeName.toLowerCase() === nodeName; - }; - }, - - "CLASS": function( className ) { - var pattern = classCache[ className + " " ]; - - return pattern || - (pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) && - classCache( className, function( elem ) { - return pattern.test( typeof elem.className === "string" && elem.className || typeof elem.getAttribute !== "undefined" && elem.getAttribute("class") || "" ); - }); - }, - - "ATTR": function( name, operator, check ) { - return function( elem ) { - var result = Sizzle.attr( elem, name ); - - if ( result == null ) { - return operator === "!="; - } - if ( !operator ) { - return true; - } - - result += ""; - - return operator === "=" ? result === check : - operator === "!=" ? result !== check : - operator === "^=" ? check && result.indexOf( check ) === 0 : - operator === "*=" ? check && result.indexOf( check ) > -1 : - operator === "$=" ? check && result.slice( -check.length ) === check : - operator === "~=" ? ( " " + result.replace( rwhitespace, " " ) + " " ).indexOf( check ) > -1 : - operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" : - false; - }; - }, - - "CHILD": function( type, what, argument, first, last ) { - var simple = type.slice( 0, 3 ) !== "nth", - forward = type.slice( -4 ) !== "last", - ofType = what === "of-type"; - - return first === 1 && last === 0 ? - - // Shortcut for :nth-*(n) - function( elem ) { - return !!elem.parentNode; - } : - - function( elem, context, xml ) { - var cache, uniqueCache, outerCache, node, nodeIndex, start, - dir = simple !== forward ? "nextSibling" : "previousSibling", - parent = elem.parentNode, - name = ofType && elem.nodeName.toLowerCase(), - useCache = !xml && !ofType, - diff = false; - - if ( parent ) { - - // :(first|last|only)-(child|of-type) - if ( simple ) { - while ( dir ) { - node = elem; - while ( (node = node[ dir ]) ) { - if ( ofType ? - node.nodeName.toLowerCase() === name : - node.nodeType === 1 ) { - - return false; - } - } - // Reverse direction for :only-* (if we haven't yet done so) - start = dir = type === "only" && !start && "nextSibling"; - } - return true; - } - - start = [ forward ? parent.firstChild : parent.lastChild ]; - - // non-xml :nth-child(...) stores cache data on `parent` - if ( forward && useCache ) { - - // Seek `elem` from a previously-cached index - - // ...in a gzip-friendly way - node = parent; - outerCache = node[ expando ] || (node[ expando ] = {}); - - // Support: IE <9 only - // Defend against cloned attroperties (jQuery gh-1709) - uniqueCache = outerCache[ node.uniqueID ] || - (outerCache[ node.uniqueID ] = {}); - - cache = uniqueCache[ type ] || []; - nodeIndex = cache[ 0 ] === dirruns && cache[ 1 ]; - diff = nodeIndex && cache[ 2 ]; - node = nodeIndex && parent.childNodes[ nodeIndex ]; - - while ( (node = ++nodeIndex && node && node[ dir ] || - - // Fallback to seeking `elem` from the start - (diff = nodeIndex = 0) || start.pop()) ) { - - // When found, cache indexes on `parent` and break - if ( node.nodeType === 1 && ++diff && node === elem ) { - uniqueCache[ type ] = [ dirruns, nodeIndex, diff ]; - break; - } - } - - } else { - // Use previously-cached element index if available - if ( useCache ) { - // ...in a gzip-friendly way - node = elem; - outerCache = node[ expando ] || (node[ expando ] = {}); - - // Support: IE <9 only - // Defend against cloned attroperties (jQuery gh-1709) - uniqueCache = outerCache[ node.uniqueID ] || - (outerCache[ node.uniqueID ] = {}); - - cache = uniqueCache[ type ] || []; - nodeIndex = cache[ 0 ] === dirruns && cache[ 1 ]; - diff = nodeIndex; - } - - // xml :nth-child(...) - // or :nth-last-child(...) or :nth(-last)?-of-type(...) - if ( diff === false ) { - // Use the same loop as above to seek `elem` from the start - while ( (node = ++nodeIndex && node && node[ dir ] || - (diff = nodeIndex = 0) || start.pop()) ) { - - if ( ( ofType ? - node.nodeName.toLowerCase() === name : - node.nodeType === 1 ) && - ++diff ) { - - // Cache the index of each encountered element - if ( useCache ) { - outerCache = node[ expando ] || (node[ expando ] = {}); - - // Support: IE <9 only - // Defend against cloned attroperties (jQuery gh-1709) - uniqueCache = outerCache[ node.uniqueID ] || - (outerCache[ node.uniqueID ] = {}); - - uniqueCache[ type ] = [ dirruns, diff ]; - } - - if ( node === elem ) { - break; - } - } - } - } - } - - // Incorporate the offset, then check against cycle size - diff -= last; - return diff === first || ( diff % first === 0 && diff / first >= 0 ); - } - }; - }, - - "PSEUDO": function( pseudo, argument ) { - // pseudo-class names are case-insensitive - // http://www.w3.org/TR/selectors/#pseudo-classes - // Prioritize by case sensitivity in case custom pseudos are added with uppercase letters - // Remember that setFilters inherits from pseudos - var args, - fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] || - Sizzle.error( "unsupported pseudo: " + pseudo ); - - // The user may use createPseudo to indicate that - // arguments are needed to create the filter function - // just as Sizzle does - if ( fn[ expando ] ) { - return fn( argument ); - } - - // But maintain support for old signatures - if ( fn.length > 1 ) { - args = [ pseudo, pseudo, "", argument ]; - return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ? - markFunction(function( seed, matches ) { - var idx, - matched = fn( seed, argument ), - i = matched.length; - while ( i-- ) { - idx = indexOf( seed, matched[i] ); - seed[ idx ] = !( matches[ idx ] = matched[i] ); - } - }) : - function( elem ) { - return fn( elem, 0, args ); - }; - } - - return fn; - } - }, - - pseudos: { - // Potentially complex pseudos - "not": markFunction(function( selector ) { - // Trim the selector passed to compile - // to avoid treating leading and trailing - // spaces as combinators - var input = [], - results = [], - matcher = compile( selector.replace( rtrim, "$1" ) ); - - return matcher[ expando ] ? - markFunction(function( seed, matches, context, xml ) { - var elem, - unmatched = matcher( seed, null, xml, [] ), - i = seed.length; - - // Match elements unmatched by `matcher` - while ( i-- ) { - if ( (elem = unmatched[i]) ) { - seed[i] = !(matches[i] = elem); - } - } - }) : - function( elem, context, xml ) { - input[0] = elem; - matcher( input, null, xml, results ); - // Don't keep the element (issue #299) - input[0] = null; - return !results.pop(); - }; - }), - - "has": markFunction(function( selector ) { - return function( elem ) { - return Sizzle( selector, elem ).length > 0; - }; - }), - - "contains": markFunction(function( text ) { - text = text.replace( runescape, funescape ); - return function( elem ) { - return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1; - }; - }), - - // "Whether an element is represented by a :lang() selector - // is based solely on the element's language value - // being equal to the identifier C, - // or beginning with the identifier C immediately followed by "-". - // The matching of C against the element's language value is performed case-insensitively. - // The identifier C does not have to be a valid language name." - // http://www.w3.org/TR/selectors/#lang-pseudo - "lang": markFunction( function( lang ) { - // lang value must be a valid identifier - if ( !ridentifier.test(lang || "") ) { - Sizzle.error( "unsupported lang: " + lang ); - } - lang = lang.replace( runescape, funescape ).toLowerCase(); - return function( elem ) { - var elemLang; - do { - if ( (elemLang = documentIsHTML ? - elem.lang : - elem.getAttribute("xml:lang") || elem.getAttribute("lang")) ) { - - elemLang = elemLang.toLowerCase(); - return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0; - } - } while ( (elem = elem.parentNode) && elem.nodeType === 1 ); - return false; - }; - }), - - // Miscellaneous - "target": function( elem ) { - var hash = window.location && window.location.hash; - return hash && hash.slice( 1 ) === elem.id; - }, - - "root": function( elem ) { - return elem === docElem; - }, - - "focus": function( elem ) { - return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex); - }, - - // Boolean properties - "enabled": createDisabledPseudo( false ), - "disabled": createDisabledPseudo( true ), - - "checked": function( elem ) { - // In CSS3, :checked should return both checked and selected elements - // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked - var nodeName = elem.nodeName.toLowerCase(); - return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected); - }, - - "selected": function( elem ) { - // Accessing this property makes selected-by-default - // options in Safari work properly - if ( elem.parentNode ) { - elem.parentNode.selectedIndex; - } - - return elem.selected === true; - }, - - // Contents - "empty": function( elem ) { - // http://www.w3.org/TR/selectors/#empty-pseudo - // :empty is negated by element (1) or content nodes (text: 3; cdata: 4; entity ref: 5), - // but not by others (comment: 8; processing instruction: 7; etc.) - // nodeType < 6 works because attributes (2) do not appear as children - for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { - if ( elem.nodeType < 6 ) { - return false; - } - } - return true; - }, - - "parent": function( elem ) { - return !Expr.pseudos["empty"]( elem ); - }, - - // Element/input types - "header": function( elem ) { - return rheader.test( elem.nodeName ); - }, - - "input": function( elem ) { - return rinputs.test( elem.nodeName ); - }, - - "button": function( elem ) { - var name = elem.nodeName.toLowerCase(); - return name === "input" && elem.type === "button" || name === "button"; - }, - - "text": function( elem ) { - var attr; - return elem.nodeName.toLowerCase() === "input" && - elem.type === "text" && - - // Support: IE<8 - // New HTML5 attribute values (e.g., "search") appear with elem.type === "text" - ( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === "text" ); - }, - - // Position-in-collection - "first": createPositionalPseudo(function() { - return [ 0 ]; - }), - - "last": createPositionalPseudo(function( matchIndexes, length ) { - return [ length - 1 ]; - }), - - "eq": createPositionalPseudo(function( matchIndexes, length, argument ) { - return [ argument < 0 ? argument + length : argument ]; - }), - - "even": createPositionalPseudo(function( matchIndexes, length ) { - var i = 0; - for ( ; i < length; i += 2 ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "odd": createPositionalPseudo(function( matchIndexes, length ) { - var i = 1; - for ( ; i < length; i += 2 ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "lt": createPositionalPseudo(function( matchIndexes, length, argument ) { - var i = argument < 0 ? argument + length : argument; - for ( ; --i >= 0; ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "gt": createPositionalPseudo(function( matchIndexes, length, argument ) { - var i = argument < 0 ? argument + length : argument; - for ( ; ++i < length; ) { - matchIndexes.push( i ); - } - return matchIndexes; - }) - } -}; - -Expr.pseudos["nth"] = Expr.pseudos["eq"]; - -// Add button/input type pseudos -for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) { - Expr.pseudos[ i ] = createInputPseudo( i ); -} -for ( i in { submit: true, reset: true } ) { - Expr.pseudos[ i ] = createButtonPseudo( i ); -} - -// Easy API for creating new setFilters -function setFilters() {} -setFilters.prototype = Expr.filters = Expr.pseudos; -Expr.setFilters = new setFilters(); - -tokenize = Sizzle.tokenize = function( selector, parseOnly ) { - var matched, match, tokens, type, - soFar, groups, preFilters, - cached = tokenCache[ selector + " " ]; - - if ( cached ) { - return parseOnly ? 0 : cached.slice( 0 ); - } - - soFar = selector; - groups = []; - preFilters = Expr.preFilter; - - while ( soFar ) { - - // Comma and first run - if ( !matched || (match = rcomma.exec( soFar )) ) { - if ( match ) { - // Don't consume trailing commas as valid - soFar = soFar.slice( match[0].length ) || soFar; - } - groups.push( (tokens = []) ); - } - - matched = false; - - // Combinators - if ( (match = rcombinators.exec( soFar )) ) { - matched = match.shift(); - tokens.push({ - value: matched, - // Cast descendant combinators to space - type: match[0].replace( rtrim, " " ) - }); - soFar = soFar.slice( matched.length ); - } - - // Filters - for ( type in Expr.filter ) { - if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] || - (match = preFilters[ type ]( match ))) ) { - matched = match.shift(); - tokens.push({ - value: matched, - type: type, - matches: match - }); - soFar = soFar.slice( matched.length ); - } - } - - if ( !matched ) { - break; - } - } - - // Return the length of the invalid excess - // if we're just parsing - // Otherwise, throw an error or return tokens - return parseOnly ? - soFar.length : - soFar ? - Sizzle.error( selector ) : - // Cache the tokens - tokenCache( selector, groups ).slice( 0 ); -}; - -function toSelector( tokens ) { - var i = 0, - len = tokens.length, - selector = ""; - for ( ; i < len; i++ ) { - selector += tokens[i].value; - } - return selector; -} - -function addCombinator( matcher, combinator, base ) { - var dir = combinator.dir, - skip = combinator.next, - key = skip || dir, - checkNonElements = base && key === "parentNode", - doneName = done++; - - return combinator.first ? - // Check against closest ancestor/preceding element - function( elem, context, xml ) { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - return matcher( elem, context, xml ); - } - } - return false; - } : - - // Check against all ancestor/preceding elements - function( elem, context, xml ) { - var oldCache, uniqueCache, outerCache, - newCache = [ dirruns, doneName ]; - - // We can't set arbitrary data on XML nodes, so they don't benefit from combinator caching - if ( xml ) { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - if ( matcher( elem, context, xml ) ) { - return true; - } - } - } - } else { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - outerCache = elem[ expando ] || (elem[ expando ] = {}); - - // Support: IE <9 only - // Defend against cloned attroperties (jQuery gh-1709) - uniqueCache = outerCache[ elem.uniqueID ] || (outerCache[ elem.uniqueID ] = {}); - - if ( skip && skip === elem.nodeName.toLowerCase() ) { - elem = elem[ dir ] || elem; - } else if ( (oldCache = uniqueCache[ key ]) && - oldCache[ 0 ] === dirruns && oldCache[ 1 ] === doneName ) { - - // Assign to newCache so results back-propagate to previous elements - return (newCache[ 2 ] = oldCache[ 2 ]); - } else { - // Reuse newcache so results back-propagate to previous elements - uniqueCache[ key ] = newCache; - - // A match means we're done; a fail means we have to keep checking - if ( (newCache[ 2 ] = matcher( elem, context, xml )) ) { - return true; - } - } - } - } - } - return false; - }; -} - -function elementMatcher( matchers ) { - return matchers.length > 1 ? - function( elem, context, xml ) { - var i = matchers.length; - while ( i-- ) { - if ( !matchers[i]( elem, context, xml ) ) { - return false; - } - } - return true; - } : - matchers[0]; -} - -function multipleContexts( selector, contexts, results ) { - var i = 0, - len = contexts.length; - for ( ; i < len; i++ ) { - Sizzle( selector, contexts[i], results ); - } - return results; -} - -function condense( unmatched, map, filter, context, xml ) { - var elem, - newUnmatched = [], - i = 0, - len = unmatched.length, - mapped = map != null; - - for ( ; i < len; i++ ) { - if ( (elem = unmatched[i]) ) { - if ( !filter || filter( elem, context, xml ) ) { - newUnmatched.push( elem ); - if ( mapped ) { - map.push( i ); - } - } - } - } - - return newUnmatched; -} - -function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) { - if ( postFilter && !postFilter[ expando ] ) { - postFilter = setMatcher( postFilter ); - } - if ( postFinder && !postFinder[ expando ] ) { - postFinder = setMatcher( postFinder, postSelector ); - } - return markFunction(function( seed, results, context, xml ) { - var temp, i, elem, - preMap = [], - postMap = [], - preexisting = results.length, - - // Get initial elements from seed or context - elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ), - - // Prefilter to get matcher input, preserving a map for seed-results synchronization - matcherIn = preFilter && ( seed || !selector ) ? - condense( elems, preMap, preFilter, context, xml ) : - elems, - - matcherOut = matcher ? - // If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results, - postFinder || ( seed ? preFilter : preexisting || postFilter ) ? - - // ...intermediate processing is necessary - [] : - - // ...otherwise use results directly - results : - matcherIn; - - // Find primary matches - if ( matcher ) { - matcher( matcherIn, matcherOut, context, xml ); - } - - // Apply postFilter - if ( postFilter ) { - temp = condense( matcherOut, postMap ); - postFilter( temp, [], context, xml ); - - // Un-match failing elements by moving them back to matcherIn - i = temp.length; - while ( i-- ) { - if ( (elem = temp[i]) ) { - matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem); - } - } - } - - if ( seed ) { - if ( postFinder || preFilter ) { - if ( postFinder ) { - // Get the final matcherOut by condensing this intermediate into postFinder contexts - temp = []; - i = matcherOut.length; - while ( i-- ) { - if ( (elem = matcherOut[i]) ) { - // Restore matcherIn since elem is not yet a final match - temp.push( (matcherIn[i] = elem) ); - } - } - postFinder( null, (matcherOut = []), temp, xml ); - } - - // Move matched elements from seed to results to keep them synchronized - i = matcherOut.length; - while ( i-- ) { - if ( (elem = matcherOut[i]) && - (temp = postFinder ? indexOf( seed, elem ) : preMap[i]) > -1 ) { - - seed[temp] = !(results[temp] = elem); - } - } - } - - // Add elements to results, through postFinder if defined - } else { - matcherOut = condense( - matcherOut === results ? - matcherOut.splice( preexisting, matcherOut.length ) : - matcherOut - ); - if ( postFinder ) { - postFinder( null, results, matcherOut, xml ); - } else { - push.apply( results, matcherOut ); - } - } - }); -} - -function matcherFromTokens( tokens ) { - var checkContext, matcher, j, - len = tokens.length, - leadingRelative = Expr.relative[ tokens[0].type ], - implicitRelative = leadingRelative || Expr.relative[" "], - i = leadingRelative ? 1 : 0, - - // The foundational matcher ensures that elements are reachable from top-level context(s) - matchContext = addCombinator( function( elem ) { - return elem === checkContext; - }, implicitRelative, true ), - matchAnyContext = addCombinator( function( elem ) { - return indexOf( checkContext, elem ) > -1; - }, implicitRelative, true ), - matchers = [ function( elem, context, xml ) { - var ret = ( !leadingRelative && ( xml || context !== outermostContext ) ) || ( - (checkContext = context).nodeType ? - matchContext( elem, context, xml ) : - matchAnyContext( elem, context, xml ) ); - // Avoid hanging onto element (issue #299) - checkContext = null; - return ret; - } ]; - - for ( ; i < len; i++ ) { - if ( (matcher = Expr.relative[ tokens[i].type ]) ) { - matchers = [ addCombinator(elementMatcher( matchers ), matcher) ]; - } else { - matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches ); - - // Return special upon seeing a positional matcher - if ( matcher[ expando ] ) { - // Find the next relative operator (if any) for proper handling - j = ++i; - for ( ; j < len; j++ ) { - if ( Expr.relative[ tokens[j].type ] ) { - break; - } - } - return setMatcher( - i > 1 && elementMatcher( matchers ), - i > 1 && toSelector( - // If the preceding token was a descendant combinator, insert an implicit any-element `*` - tokens.slice( 0, i - 1 ).concat({ value: tokens[ i - 2 ].type === " " ? "*" : "" }) - ).replace( rtrim, "$1" ), - matcher, - i < j && matcherFromTokens( tokens.slice( i, j ) ), - j < len && matcherFromTokens( (tokens = tokens.slice( j )) ), - j < len && toSelector( tokens ) - ); - } - matchers.push( matcher ); - } - } - - return elementMatcher( matchers ); -} - -function matcherFromGroupMatchers( elementMatchers, setMatchers ) { - var bySet = setMatchers.length > 0, - byElement = elementMatchers.length > 0, - superMatcher = function( seed, context, xml, results, outermost ) { - var elem, j, matcher, - matchedCount = 0, - i = "0", - unmatched = seed && [], - setMatched = [], - contextBackup = outermostContext, - // We must always have either seed elements or outermost context - elems = seed || byElement && Expr.find["TAG"]( "*", outermost ), - // Use integer dirruns iff this is the outermost matcher - dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1), - len = elems.length; - - if ( outermost ) { - outermostContext = context === document || context || outermost; - } - - // Add elements passing elementMatchers directly to results - // Support: IE<9, Safari - // Tolerate NodeList properties (IE: "length"; Safari: ) matching elements by id - for ( ; i !== len && (elem = elems[i]) != null; i++ ) { - if ( byElement && elem ) { - j = 0; - if ( !context && elem.ownerDocument !== document ) { - setDocument( elem ); - xml = !documentIsHTML; - } - while ( (matcher = elementMatchers[j++]) ) { - if ( matcher( elem, context || document, xml) ) { - results.push( elem ); - break; - } - } - if ( outermost ) { - dirruns = dirrunsUnique; - } - } - - // Track unmatched elements for set filters - if ( bySet ) { - // They will have gone through all possible matchers - if ( (elem = !matcher && elem) ) { - matchedCount--; - } - - // Lengthen the array for every element, matched or not - if ( seed ) { - unmatched.push( elem ); - } - } - } - - // `i` is now the count of elements visited above, and adding it to `matchedCount` - // makes the latter nonnegative. - matchedCount += i; - - // Apply set filters to unmatched elements - // NOTE: This can be skipped if there are no unmatched elements (i.e., `matchedCount` - // equals `i`), unless we didn't visit _any_ elements in the above loop because we have - // no element matchers and no seed. - // Incrementing an initially-string "0" `i` allows `i` to remain a string only in that - // case, which will result in a "00" `matchedCount` that differs from `i` but is also - // numerically zero. - if ( bySet && i !== matchedCount ) { - j = 0; - while ( (matcher = setMatchers[j++]) ) { - matcher( unmatched, setMatched, context, xml ); - } - - if ( seed ) { - // Reintegrate element matches to eliminate the need for sorting - if ( matchedCount > 0 ) { - while ( i-- ) { - if ( !(unmatched[i] || setMatched[i]) ) { - setMatched[i] = pop.call( results ); - } - } - } - - // Discard index placeholder values to get only actual matches - setMatched = condense( setMatched ); - } - - // Add matches to results - push.apply( results, setMatched ); - - // Seedless set matches succeeding multiple successful matchers stipulate sorting - if ( outermost && !seed && setMatched.length > 0 && - ( matchedCount + setMatchers.length ) > 1 ) { - - Sizzle.uniqueSort( results ); - } - } - - // Override manipulation of globals by nested matchers - if ( outermost ) { - dirruns = dirrunsUnique; - outermostContext = contextBackup; - } - - return unmatched; - }; - - return bySet ? - markFunction( superMatcher ) : - superMatcher; -} - -compile = Sizzle.compile = function( selector, match /* Internal Use Only */ ) { - var i, - setMatchers = [], - elementMatchers = [], - cached = compilerCache[ selector + " " ]; - - if ( !cached ) { - // Generate a function of recursive functions that can be used to check each element - if ( !match ) { - match = tokenize( selector ); - } - i = match.length; - while ( i-- ) { - cached = matcherFromTokens( match[i] ); - if ( cached[ expando ] ) { - setMatchers.push( cached ); - } else { - elementMatchers.push( cached ); - } - } - - // Cache the compiled function - cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) ); - - // Save selector and tokenization - cached.selector = selector; - } - return cached; -}; - -/** - * A low-level selection function that works with Sizzle's compiled - * selector functions - * @param {String|Function} selector A selector or a pre-compiled - * selector function built with Sizzle.compile - * @param {Element} context - * @param {Array} [results] - * @param {Array} [seed] A set of elements to match against - */ -select = Sizzle.select = function( selector, context, results, seed ) { - var i, tokens, token, type, find, - compiled = typeof selector === "function" && selector, - match = !seed && tokenize( (selector = compiled.selector || selector) ); - - results = results || []; - - // Try to minimize operations if there is only one selector in the list and no seed - // (the latter of which guarantees us context) - if ( match.length === 1 ) { - - // Reduce context if the leading compound selector is an ID - tokens = match[0] = match[0].slice( 0 ); - if ( tokens.length > 2 && (token = tokens[0]).type === "ID" && - context.nodeType === 9 && documentIsHTML && Expr.relative[ tokens[1].type ] ) { - - context = ( Expr.find["ID"]( token.matches[0].replace(runescape, funescape), context ) || [] )[0]; - if ( !context ) { - return results; - - // Precompiled matchers will still verify ancestry, so step up a level - } else if ( compiled ) { - context = context.parentNode; - } - - selector = selector.slice( tokens.shift().value.length ); - } - - // Fetch a seed set for right-to-left matching - i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length; - while ( i-- ) { - token = tokens[i]; - - // Abort if we hit a combinator - if ( Expr.relative[ (type = token.type) ] ) { - break; - } - if ( (find = Expr.find[ type ]) ) { - // Search, expanding context for leading sibling combinators - if ( (seed = find( - token.matches[0].replace( runescape, funescape ), - rsibling.test( tokens[0].type ) && testContext( context.parentNode ) || context - )) ) { - - // If seed is empty or no tokens remain, we can return early - tokens.splice( i, 1 ); - selector = seed.length && toSelector( tokens ); - if ( !selector ) { - push.apply( results, seed ); - return results; - } - - break; - } - } - } - } - - // Compile and execute a filtering function if one is not provided - // Provide `match` to avoid retokenization if we modified the selector above - ( compiled || compile( selector, match ) )( - seed, - context, - !documentIsHTML, - results, - !context || rsibling.test( selector ) && testContext( context.parentNode ) || context - ); - return results; -}; - -// One-time assignments - -// Sort stability -support.sortStable = expando.split("").sort( sortOrder ).join("") === expando; - -// Support: Chrome 14-35+ -// Always assume duplicates if they aren't passed to the comparison function -support.detectDuplicates = !!hasDuplicate; - -// Initialize against the default document -setDocument(); - -// Support: Webkit<537.32 - Safari 6.0.3/Chrome 25 (fixed in Chrome 27) -// Detached nodes confoundingly follow *each other* -support.sortDetached = assert(function( el ) { - // Should return 1, but returns 4 (following) - return el.compareDocumentPosition( document.createElement("fieldset") ) & 1; -}); - -// Support: IE<8 -// Prevent attribute/property "interpolation" -// https://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx -if ( !assert(function( el ) { - el.innerHTML = ""; - return el.firstChild.getAttribute("href") === "#" ; -}) ) { - addHandle( "type|href|height|width", function( elem, name, isXML ) { - if ( !isXML ) { - return elem.getAttribute( name, name.toLowerCase() === "type" ? 1 : 2 ); - } - }); -} - -// Support: IE<9 -// Use defaultValue in place of getAttribute("value") -if ( !support.attributes || !assert(function( el ) { - el.innerHTML = ""; - el.firstChild.setAttribute( "value", "" ); - return el.firstChild.getAttribute( "value" ) === ""; -}) ) { - addHandle( "value", function( elem, name, isXML ) { - if ( !isXML && elem.nodeName.toLowerCase() === "input" ) { - return elem.defaultValue; - } - }); -} - -// Support: IE<9 -// Use getAttributeNode to fetch booleans when getAttribute lies -if ( !assert(function( el ) { - return el.getAttribute("disabled") == null; -}) ) { - addHandle( booleans, function( elem, name, isXML ) { - var val; - if ( !isXML ) { - return elem[ name ] === true ? name.toLowerCase() : - (val = elem.getAttributeNode( name )) && val.specified ? - val.value : - null; - } - }); -} - -return Sizzle; - -})( window ); - - - -jQuery.find = Sizzle; -jQuery.expr = Sizzle.selectors; - -// Deprecated -jQuery.expr[ ":" ] = jQuery.expr.pseudos; -jQuery.uniqueSort = jQuery.unique = Sizzle.uniqueSort; -jQuery.text = Sizzle.getText; -jQuery.isXMLDoc = Sizzle.isXML; -jQuery.contains = Sizzle.contains; -jQuery.escapeSelector = Sizzle.escape; - - - - -var dir = function( elem, dir, until ) { - var matched = [], - truncate = until !== undefined; - - while ( ( elem = elem[ dir ] ) && elem.nodeType !== 9 ) { - if ( elem.nodeType === 1 ) { - if ( truncate && jQuery( elem ).is( until ) ) { - break; - } - matched.push( elem ); - } - } - return matched; -}; - - -var siblings = function( n, elem ) { - var matched = []; - - for ( ; n; n = n.nextSibling ) { - if ( n.nodeType === 1 && n !== elem ) { - matched.push( n ); - } - } - - return matched; -}; - - -var rneedsContext = jQuery.expr.match.needsContext; - - - -function nodeName( elem, name ) { - - return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase(); - -}; -var rsingleTag = ( /^<([a-z][^\/\0>:\x20\t\r\n\f]*)[\x20\t\r\n\f]*\/?>(?:<\/\1>|)$/i ); - - - -var risSimple = /^.[^:#\[\.,]*$/; - -// Implement the identical functionality for filter and not -function winnow( elements, qualifier, not ) { - if ( jQuery.isFunction( qualifier ) ) { - return jQuery.grep( elements, function( elem, i ) { - return !!qualifier.call( elem, i, elem ) !== not; - } ); - } - - // Single element - if ( qualifier.nodeType ) { - return jQuery.grep( elements, function( elem ) { - return ( elem === qualifier ) !== not; - } ); - } - - // Arraylike of elements (jQuery, arguments, Array) - if ( typeof qualifier !== "string" ) { - return jQuery.grep( elements, function( elem ) { - return ( indexOf.call( qualifier, elem ) > -1 ) !== not; - } ); - } - - // Simple selector that can be filtered directly, removing non-Elements - if ( risSimple.test( qualifier ) ) { - return jQuery.filter( qualifier, elements, not ); - } - - // Complex selector, compare the two sets, removing non-Elements - qualifier = jQuery.filter( qualifier, elements ); - return jQuery.grep( elements, function( elem ) { - return ( indexOf.call( qualifier, elem ) > -1 ) !== not && elem.nodeType === 1; - } ); -} - -jQuery.filter = function( expr, elems, not ) { - var elem = elems[ 0 ]; - - if ( not ) { - expr = ":not(" + expr + ")"; - } - - if ( elems.length === 1 && elem.nodeType === 1 ) { - return jQuery.find.matchesSelector( elem, expr ) ? [ elem ] : []; - } - - return jQuery.find.matches( expr, jQuery.grep( elems, function( elem ) { - return elem.nodeType === 1; - } ) ); -}; - -jQuery.fn.extend( { - find: function( selector ) { - var i, ret, - len = this.length, - self = this; - - if ( typeof selector !== "string" ) { - return this.pushStack( jQuery( selector ).filter( function() { - for ( i = 0; i < len; i++ ) { - if ( jQuery.contains( self[ i ], this ) ) { - return true; - } - } - } ) ); - } - - ret = this.pushStack( [] ); - - for ( i = 0; i < len; i++ ) { - jQuery.find( selector, self[ i ], ret ); - } - - return len > 1 ? jQuery.uniqueSort( ret ) : ret; - }, - filter: function( selector ) { - return this.pushStack( winnow( this, selector || [], false ) ); - }, - not: function( selector ) { - return this.pushStack( winnow( this, selector || [], true ) ); - }, - is: function( selector ) { - return !!winnow( - this, - - // If this is a positional/relative selector, check membership in the returned set - // so $("p:first").is("p:last") won't return true for a doc with two "p". - typeof selector === "string" && rneedsContext.test( selector ) ? - jQuery( selector ) : - selector || [], - false - ).length; - } -} ); - - -// Initialize a jQuery object - - -// A central reference to the root jQuery(document) -var rootjQuery, - - // A simple way to check for HTML strings - // Prioritize #id over to avoid XSS via location.hash (#9521) - // Strict HTML recognition (#11290: must start with <) - // Shortcut simple #id case for speed - rquickExpr = /^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]+))$/, - - init = jQuery.fn.init = function( selector, context, root ) { - var match, elem; - - // HANDLE: $(""), $(null), $(undefined), $(false) - if ( !selector ) { - return this; - } - - // Method init() accepts an alternate rootjQuery - // so migrate can support jQuery.sub (gh-2101) - root = root || rootjQuery; - - // Handle HTML strings - if ( typeof selector === "string" ) { - if ( selector[ 0 ] === "<" && - selector[ selector.length - 1 ] === ">" && - selector.length >= 3 ) { - - // Assume that strings that start and end with <> are HTML and skip the regex check - match = [ null, selector, null ]; - - } else { - match = rquickExpr.exec( selector ); - } - - // Match html or make sure no context is specified for #id - if ( match && ( match[ 1 ] || !context ) ) { - - // HANDLE: $(html) -> $(array) - if ( match[ 1 ] ) { - context = context instanceof jQuery ? context[ 0 ] : context; - - // Option to run scripts is true for back-compat - // Intentionally let the error be thrown if parseHTML is not present - jQuery.merge( this, jQuery.parseHTML( - match[ 1 ], - context && context.nodeType ? context.ownerDocument || context : document, - true - ) ); - - // HANDLE: $(html, props) - if ( rsingleTag.test( match[ 1 ] ) && jQuery.isPlainObject( context ) ) { - for ( match in context ) { - - // Properties of context are called as methods if possible - if ( jQuery.isFunction( this[ match ] ) ) { - this[ match ]( context[ match ] ); - - // ...and otherwise set as attributes - } else { - this.attr( match, context[ match ] ); - } - } - } - - return this; - - // HANDLE: $(#id) - } else { - elem = document.getElementById( match[ 2 ] ); - - if ( elem ) { - - // Inject the element directly into the jQuery object - this[ 0 ] = elem; - this.length = 1; - } - return this; - } - - // HANDLE: $(expr, $(...)) - } else if ( !context || context.jquery ) { - return ( context || root ).find( selector ); - - // HANDLE: $(expr, context) - // (which is just equivalent to: $(context).find(expr) - } else { - return this.constructor( context ).find( selector ); - } - - // HANDLE: $(DOMElement) - } else if ( selector.nodeType ) { - this[ 0 ] = selector; - this.length = 1; - return this; - - // HANDLE: $(function) - // Shortcut for document ready - } else if ( jQuery.isFunction( selector ) ) { - return root.ready !== undefined ? - root.ready( selector ) : - - // Execute immediately if ready is not present - selector( jQuery ); - } - - return jQuery.makeArray( selector, this ); - }; - -// Give the init function the jQuery prototype for later instantiation -init.prototype = jQuery.fn; - -// Initialize central reference -rootjQuery = jQuery( document ); - - -var rparentsprev = /^(?:parents|prev(?:Until|All))/, - - // Methods guaranteed to produce a unique set when starting from a unique set - guaranteedUnique = { - children: true, - contents: true, - next: true, - prev: true - }; - -jQuery.fn.extend( { - has: function( target ) { - var targets = jQuery( target, this ), - l = targets.length; - - return this.filter( function() { - var i = 0; - for ( ; i < l; i++ ) { - if ( jQuery.contains( this, targets[ i ] ) ) { - return true; - } - } - } ); - }, - - closest: function( selectors, context ) { - var cur, - i = 0, - l = this.length, - matched = [], - targets = typeof selectors !== "string" && jQuery( selectors ); - - // Positional selectors never match, since there's no _selection_ context - if ( !rneedsContext.test( selectors ) ) { - for ( ; i < l; i++ ) { - for ( cur = this[ i ]; cur && cur !== context; cur = cur.parentNode ) { - - // Always skip document fragments - if ( cur.nodeType < 11 && ( targets ? - targets.index( cur ) > -1 : - - // Don't pass non-elements to Sizzle - cur.nodeType === 1 && - jQuery.find.matchesSelector( cur, selectors ) ) ) { - - matched.push( cur ); - break; - } - } - } - } - - return this.pushStack( matched.length > 1 ? jQuery.uniqueSort( matched ) : matched ); - }, - - // Determine the position of an element within the set - index: function( elem ) { - - // No argument, return index in parent - if ( !elem ) { - return ( this[ 0 ] && this[ 0 ].parentNode ) ? this.first().prevAll().length : -1; - } - - // Index in selector - if ( typeof elem === "string" ) { - return indexOf.call( jQuery( elem ), this[ 0 ] ); - } - - // Locate the position of the desired element - return indexOf.call( this, - - // If it receives a jQuery object, the first element is used - elem.jquery ? elem[ 0 ] : elem - ); - }, - - add: function( selector, context ) { - return this.pushStack( - jQuery.uniqueSort( - jQuery.merge( this.get(), jQuery( selector, context ) ) - ) - ); - }, - - addBack: function( selector ) { - return this.add( selector == null ? - this.prevObject : this.prevObject.filter( selector ) - ); - } -} ); - -function sibling( cur, dir ) { - while ( ( cur = cur[ dir ] ) && cur.nodeType !== 1 ) {} - return cur; -} - -jQuery.each( { - parent: function( elem ) { - var parent = elem.parentNode; - return parent && parent.nodeType !== 11 ? parent : null; - }, - parents: function( elem ) { - return dir( elem, "parentNode" ); - }, - parentsUntil: function( elem, i, until ) { - return dir( elem, "parentNode", until ); - }, - next: function( elem ) { - return sibling( elem, "nextSibling" ); - }, - prev: function( elem ) { - return sibling( elem, "previousSibling" ); - }, - nextAll: function( elem ) { - return dir( elem, "nextSibling" ); - }, - prevAll: function( elem ) { - return dir( elem, "previousSibling" ); - }, - nextUntil: function( elem, i, until ) { - return dir( elem, "nextSibling", until ); - }, - prevUntil: function( elem, i, until ) { - return dir( elem, "previousSibling", until ); - }, - siblings: function( elem ) { - return siblings( ( elem.parentNode || {} ).firstChild, elem ); - }, - children: function( elem ) { - return siblings( elem.firstChild ); - }, - contents: function( elem ) { - if ( nodeName( elem, "iframe" ) ) { - return elem.contentDocument; - } - - // Support: IE 9 - 11 only, iOS 7 only, Android Browser <=4.3 only - // Treat the template element as a regular one in browsers that - // don't support it. - if ( nodeName( elem, "template" ) ) { - elem = elem.content || elem; - } - - return jQuery.merge( [], elem.childNodes ); - } -}, function( name, fn ) { - jQuery.fn[ name ] = function( until, selector ) { - var matched = jQuery.map( this, fn, until ); - - if ( name.slice( -5 ) !== "Until" ) { - selector = until; - } - - if ( selector && typeof selector === "string" ) { - matched = jQuery.filter( selector, matched ); - } - - if ( this.length > 1 ) { - - // Remove duplicates - if ( !guaranteedUnique[ name ] ) { - jQuery.uniqueSort( matched ); - } - - // Reverse order for parents* and prev-derivatives - if ( rparentsprev.test( name ) ) { - matched.reverse(); - } - } - - return this.pushStack( matched ); - }; -} ); -var rnothtmlwhite = ( /[^\x20\t\r\n\f]+/g ); - - - -// Convert String-formatted options into Object-formatted ones -function createOptions( options ) { - var object = {}; - jQuery.each( options.match( rnothtmlwhite ) || [], function( _, flag ) { - object[ flag ] = true; - } ); - return object; -} - -/* - * Create a callback list using the following parameters: - * - * options: an optional list of space-separated options that will change how - * the callback list behaves or a more traditional option object - * - * By default a callback list will act like an event callback list and can be - * "fired" multiple times. - * - * Possible options: - * - * once: will ensure the callback list can only be fired once (like a Deferred) - * - * memory: will keep track of previous values and will call any callback added - * after the list has been fired right away with the latest "memorized" - * values (like a Deferred) - * - * unique: will ensure a callback can only be added once (no duplicate in the list) - * - * stopOnFalse: interrupt callings when a callback returns false - * - */ -jQuery.Callbacks = function( options ) { - - // Convert options from String-formatted to Object-formatted if needed - // (we check in cache first) - options = typeof options === "string" ? - createOptions( options ) : - jQuery.extend( {}, options ); - - var // Flag to know if list is currently firing - firing, - - // Last fire value for non-forgettable lists - memory, - - // Flag to know if list was already fired - fired, - - // Flag to prevent firing - locked, - - // Actual callback list - list = [], - - // Queue of execution data for repeatable lists - queue = [], - - // Index of currently firing callback (modified by add/remove as needed) - firingIndex = -1, - - // Fire callbacks - fire = function() { - - // Enforce single-firing - locked = locked || options.once; - - // Execute callbacks for all pending executions, - // respecting firingIndex overrides and runtime changes - fired = firing = true; - for ( ; queue.length; firingIndex = -1 ) { - memory = queue.shift(); - while ( ++firingIndex < list.length ) { - - // Run callback and check for early termination - if ( list[ firingIndex ].apply( memory[ 0 ], memory[ 1 ] ) === false && - options.stopOnFalse ) { - - // Jump to end and forget the data so .add doesn't re-fire - firingIndex = list.length; - memory = false; - } - } - } - - // Forget the data if we're done with it - if ( !options.memory ) { - memory = false; - } - - firing = false; - - // Clean up if we're done firing for good - if ( locked ) { - - // Keep an empty list if we have data for future add calls - if ( memory ) { - list = []; - - // Otherwise, this object is spent - } else { - list = ""; - } - } - }, - - // Actual Callbacks object - self = { - - // Add a callback or a collection of callbacks to the list - add: function() { - if ( list ) { - - // If we have memory from a past run, we should fire after adding - if ( memory && !firing ) { - firingIndex = list.length - 1; - queue.push( memory ); - } - - ( function add( args ) { - jQuery.each( args, function( _, arg ) { - if ( jQuery.isFunction( arg ) ) { - if ( !options.unique || !self.has( arg ) ) { - list.push( arg ); - } - } else if ( arg && arg.length && jQuery.type( arg ) !== "string" ) { - - // Inspect recursively - add( arg ); - } - } ); - } )( arguments ); - - if ( memory && !firing ) { - fire(); - } - } - return this; - }, - - // Remove a callback from the list - remove: function() { - jQuery.each( arguments, function( _, arg ) { - var index; - while ( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) { - list.splice( index, 1 ); - - // Handle firing indexes - if ( index <= firingIndex ) { - firingIndex--; - } - } - } ); - return this; - }, - - // Check if a given callback is in the list. - // If no argument is given, return whether or not list has callbacks attached. - has: function( fn ) { - return fn ? - jQuery.inArray( fn, list ) > -1 : - list.length > 0; - }, - - // Remove all callbacks from the list - empty: function() { - if ( list ) { - list = []; - } - return this; - }, - - // Disable .fire and .add - // Abort any current/pending executions - // Clear all callbacks and values - disable: function() { - locked = queue = []; - list = memory = ""; - return this; - }, - disabled: function() { - return !list; - }, - - // Disable .fire - // Also disable .add unless we have memory (since it would have no effect) - // Abort any pending executions - lock: function() { - locked = queue = []; - if ( !memory && !firing ) { - list = memory = ""; - } - return this; - }, - locked: function() { - return !!locked; - }, - - // Call all callbacks with the given context and arguments - fireWith: function( context, args ) { - if ( !locked ) { - args = args || []; - args = [ context, args.slice ? args.slice() : args ]; - queue.push( args ); - if ( !firing ) { - fire(); - } - } - return this; - }, - - // Call all the callbacks with the given arguments - fire: function() { - self.fireWith( this, arguments ); - return this; - }, - - // To know if the callbacks have already been called at least once - fired: function() { - return !!fired; - } - }; - - return self; -}; - - -function Identity( v ) { - return v; -} -function Thrower( ex ) { - throw ex; -} - -function adoptValue( value, resolve, reject, noValue ) { - var method; - - try { - - // Check for promise aspect first to privilege synchronous behavior - if ( value && jQuery.isFunction( ( method = value.promise ) ) ) { - method.call( value ).done( resolve ).fail( reject ); - - // Other thenables - } else if ( value && jQuery.isFunction( ( method = value.then ) ) ) { - method.call( value, resolve, reject ); - - // Other non-thenables - } else { - - // Control `resolve` arguments by letting Array#slice cast boolean `noValue` to integer: - // * false: [ value ].slice( 0 ) => resolve( value ) - // * true: [ value ].slice( 1 ) => resolve() - resolve.apply( undefined, [ value ].slice( noValue ) ); - } - - // For Promises/A+, convert exceptions into rejections - // Since jQuery.when doesn't unwrap thenables, we can skip the extra checks appearing in - // Deferred#then to conditionally suppress rejection. - } catch ( value ) { - - // Support: Android 4.0 only - // Strict mode functions invoked without .call/.apply get global-object context - reject.apply( undefined, [ value ] ); - } -} - -jQuery.extend( { - - Deferred: function( func ) { - var tuples = [ - - // action, add listener, callbacks, - // ... .then handlers, argument index, [final state] - [ "notify", "progress", jQuery.Callbacks( "memory" ), - jQuery.Callbacks( "memory" ), 2 ], - [ "resolve", "done", jQuery.Callbacks( "once memory" ), - jQuery.Callbacks( "once memory" ), 0, "resolved" ], - [ "reject", "fail", jQuery.Callbacks( "once memory" ), - jQuery.Callbacks( "once memory" ), 1, "rejected" ] - ], - state = "pending", - promise = { - state: function() { - return state; - }, - always: function() { - deferred.done( arguments ).fail( arguments ); - return this; - }, - "catch": function( fn ) { - return promise.then( null, fn ); - }, - - // Keep pipe for back-compat - pipe: function( /* fnDone, fnFail, fnProgress */ ) { - var fns = arguments; - - return jQuery.Deferred( function( newDefer ) { - jQuery.each( tuples, function( i, tuple ) { - - // Map tuples (progress, done, fail) to arguments (done, fail, progress) - var fn = jQuery.isFunction( fns[ tuple[ 4 ] ] ) && fns[ tuple[ 4 ] ]; - - // deferred.progress(function() { bind to newDefer or newDefer.notify }) - // deferred.done(function() { bind to newDefer or newDefer.resolve }) - // deferred.fail(function() { bind to newDefer or newDefer.reject }) - deferred[ tuple[ 1 ] ]( function() { - var returned = fn && fn.apply( this, arguments ); - if ( returned && jQuery.isFunction( returned.promise ) ) { - returned.promise() - .progress( newDefer.notify ) - .done( newDefer.resolve ) - .fail( newDefer.reject ); - } else { - newDefer[ tuple[ 0 ] + "With" ]( - this, - fn ? [ returned ] : arguments - ); - } - } ); - } ); - fns = null; - } ).promise(); - }, - then: function( onFulfilled, onRejected, onProgress ) { - var maxDepth = 0; - function resolve( depth, deferred, handler, special ) { - return function() { - var that = this, - args = arguments, - mightThrow = function() { - var returned, then; - - // Support: Promises/A+ section 2.3.3.3.3 - // https://promisesaplus.com/#point-59 - // Ignore double-resolution attempts - if ( depth < maxDepth ) { - return; - } - - returned = handler.apply( that, args ); - - // Support: Promises/A+ section 2.3.1 - // https://promisesaplus.com/#point-48 - if ( returned === deferred.promise() ) { - throw new TypeError( "Thenable self-resolution" ); - } - - // Support: Promises/A+ sections 2.3.3.1, 3.5 - // https://promisesaplus.com/#point-54 - // https://promisesaplus.com/#point-75 - // Retrieve `then` only once - then = returned && - - // Support: Promises/A+ section 2.3.4 - // https://promisesaplus.com/#point-64 - // Only check objects and functions for thenability - ( typeof returned === "object" || - typeof returned === "function" ) && - returned.then; - - // Handle a returned thenable - if ( jQuery.isFunction( then ) ) { - - // Special processors (notify) just wait for resolution - if ( special ) { - then.call( - returned, - resolve( maxDepth, deferred, Identity, special ), - resolve( maxDepth, deferred, Thrower, special ) - ); - - // Normal processors (resolve) also hook into progress - } else { - - // ...and disregard older resolution values - maxDepth++; - - then.call( - returned, - resolve( maxDepth, deferred, Identity, special ), - resolve( maxDepth, deferred, Thrower, special ), - resolve( maxDepth, deferred, Identity, - deferred.notifyWith ) - ); - } - - // Handle all other returned values - } else { - - // Only substitute handlers pass on context - // and multiple values (non-spec behavior) - if ( handler !== Identity ) { - that = undefined; - args = [ returned ]; - } - - // Process the value(s) - // Default process is resolve - ( special || deferred.resolveWith )( that, args ); - } - }, - - // Only normal processors (resolve) catch and reject exceptions - process = special ? - mightThrow : - function() { - try { - mightThrow(); - } catch ( e ) { - - if ( jQuery.Deferred.exceptionHook ) { - jQuery.Deferred.exceptionHook( e, - process.stackTrace ); - } - - // Support: Promises/A+ section 2.3.3.3.4.1 - // https://promisesaplus.com/#point-61 - // Ignore post-resolution exceptions - if ( depth + 1 >= maxDepth ) { - - // Only substitute handlers pass on context - // and multiple values (non-spec behavior) - if ( handler !== Thrower ) { - that = undefined; - args = [ e ]; - } - - deferred.rejectWith( that, args ); - } - } - }; - - // Support: Promises/A+ section 2.3.3.3.1 - // https://promisesaplus.com/#point-57 - // Re-resolve promises immediately to dodge false rejection from - // subsequent errors - if ( depth ) { - process(); - } else { - - // Call an optional hook to record the stack, in case of exception - // since it's otherwise lost when execution goes async - if ( jQuery.Deferred.getStackHook ) { - process.stackTrace = jQuery.Deferred.getStackHook(); - } - window.setTimeout( process ); - } - }; - } - - return jQuery.Deferred( function( newDefer ) { - - // progress_handlers.add( ... ) - tuples[ 0 ][ 3 ].add( - resolve( - 0, - newDefer, - jQuery.isFunction( onProgress ) ? - onProgress : - Identity, - newDefer.notifyWith - ) - ); - - // fulfilled_handlers.add( ... ) - tuples[ 1 ][ 3 ].add( - resolve( - 0, - newDefer, - jQuery.isFunction( onFulfilled ) ? - onFulfilled : - Identity - ) - ); - - // rejected_handlers.add( ... ) - tuples[ 2 ][ 3 ].add( - resolve( - 0, - newDefer, - jQuery.isFunction( onRejected ) ? - onRejected : - Thrower - ) - ); - } ).promise(); - }, - - // Get a promise for this deferred - // If obj is provided, the promise aspect is added to the object - promise: function( obj ) { - return obj != null ? jQuery.extend( obj, promise ) : promise; - } - }, - deferred = {}; - - // Add list-specific methods - jQuery.each( tuples, function( i, tuple ) { - var list = tuple[ 2 ], - stateString = tuple[ 5 ]; - - // promise.progress = list.add - // promise.done = list.add - // promise.fail = list.add - promise[ tuple[ 1 ] ] = list.add; - - // Handle state - if ( stateString ) { - list.add( - function() { - - // state = "resolved" (i.e., fulfilled) - // state = "rejected" - state = stateString; - }, - - // rejected_callbacks.disable - // fulfilled_callbacks.disable - tuples[ 3 - i ][ 2 ].disable, - - // progress_callbacks.lock - tuples[ 0 ][ 2 ].lock - ); - } - - // progress_handlers.fire - // fulfilled_handlers.fire - // rejected_handlers.fire - list.add( tuple[ 3 ].fire ); - - // deferred.notify = function() { deferred.notifyWith(...) } - // deferred.resolve = function() { deferred.resolveWith(...) } - // deferred.reject = function() { deferred.rejectWith(...) } - deferred[ tuple[ 0 ] ] = function() { - deferred[ tuple[ 0 ] + "With" ]( this === deferred ? undefined : this, arguments ); - return this; - }; - - // deferred.notifyWith = list.fireWith - // deferred.resolveWith = list.fireWith - // deferred.rejectWith = list.fireWith - deferred[ tuple[ 0 ] + "With" ] = list.fireWith; - } ); - - // Make the deferred a promise - promise.promise( deferred ); - - // Call given func if any - if ( func ) { - func.call( deferred, deferred ); - } - - // All done! - return deferred; - }, - - // Deferred helper - when: function( singleValue ) { - var - - // count of uncompleted subordinates - remaining = arguments.length, - - // count of unprocessed arguments - i = remaining, - - // subordinate fulfillment data - resolveContexts = Array( i ), - resolveValues = slice.call( arguments ), - - // the master Deferred - master = jQuery.Deferred(), - - // subordinate callback factory - updateFunc = function( i ) { - return function( value ) { - resolveContexts[ i ] = this; - resolveValues[ i ] = arguments.length > 1 ? slice.call( arguments ) : value; - if ( !( --remaining ) ) { - master.resolveWith( resolveContexts, resolveValues ); - } - }; - }; - - // Single- and empty arguments are adopted like Promise.resolve - if ( remaining <= 1 ) { - adoptValue( singleValue, master.done( updateFunc( i ) ).resolve, master.reject, - !remaining ); - - // Use .then() to unwrap secondary thenables (cf. gh-3000) - if ( master.state() === "pending" || - jQuery.isFunction( resolveValues[ i ] && resolveValues[ i ].then ) ) { - - return master.then(); - } - } - - // Multiple arguments are aggregated like Promise.all array elements - while ( i-- ) { - adoptValue( resolveValues[ i ], updateFunc( i ), master.reject ); - } - - return master.promise(); - } -} ); - - -// These usually indicate a programmer mistake during development, -// warn about them ASAP rather than swallowing them by default. -var rerrorNames = /^(Eval|Internal|Range|Reference|Syntax|Type|URI)Error$/; - -jQuery.Deferred.exceptionHook = function( error, stack ) { - - // Support: IE 8 - 9 only - // Console exists when dev tools are open, which can happen at any time - if ( window.console && window.console.warn && error && rerrorNames.test( error.name ) ) { - window.console.warn( "jQuery.Deferred exception: " + error.message, error.stack, stack ); - } -}; - - - - -jQuery.readyException = function( error ) { - window.setTimeout( function() { - throw error; - } ); -}; - - - - -// The deferred used on DOM ready -var readyList = jQuery.Deferred(); - -jQuery.fn.ready = function( fn ) { - - readyList - .then( fn ) - - // Wrap jQuery.readyException in a function so that the lookup - // happens at the time of error handling instead of callback - // registration. - .catch( function( error ) { - jQuery.readyException( error ); - } ); - - return this; -}; - -jQuery.extend( { - - // Is the DOM ready to be used? Set to true once it occurs. - isReady: false, - - // A counter to track how many items to wait for before - // the ready event fires. See #6781 - readyWait: 1, - - // Handle when the DOM is ready - ready: function( wait ) { - - // Abort if there are pending holds or we're already ready - if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) { - return; - } - - // Remember that the DOM is ready - jQuery.isReady = true; - - // If a normal DOM Ready event fired, decrement, and wait if need be - if ( wait !== true && --jQuery.readyWait > 0 ) { - return; - } - - // If there are functions bound, to execute - readyList.resolveWith( document, [ jQuery ] ); - } -} ); - -jQuery.ready.then = readyList.then; - -// The ready event handler and self cleanup method -function completed() { - document.removeEventListener( "DOMContentLoaded", completed ); - window.removeEventListener( "load", completed ); - jQuery.ready(); -} - -// Catch cases where $(document).ready() is called -// after the browser event has already occurred. -// Support: IE <=9 - 10 only -// Older IE sometimes signals "interactive" too soon -if ( document.readyState === "complete" || - ( document.readyState !== "loading" && !document.documentElement.doScroll ) ) { - - // Handle it asynchronously to allow scripts the opportunity to delay ready - window.setTimeout( jQuery.ready ); - -} else { - - // Use the handy event callback - document.addEventListener( "DOMContentLoaded", completed ); - - // A fallback to window.onload, that will always work - window.addEventListener( "load", completed ); -} - - - - -// Multifunctional method to get and set values of a collection -// The value/s can optionally be executed if it's a function -var access = function( elems, fn, key, value, chainable, emptyGet, raw ) { - var i = 0, - len = elems.length, - bulk = key == null; - - // Sets many values - if ( jQuery.type( key ) === "object" ) { - chainable = true; - for ( i in key ) { - access( elems, fn, i, key[ i ], true, emptyGet, raw ); - } - - // Sets one value - } else if ( value !== undefined ) { - chainable = true; - - if ( !jQuery.isFunction( value ) ) { - raw = true; - } - - if ( bulk ) { - - // Bulk operations run against the entire set - if ( raw ) { - fn.call( elems, value ); - fn = null; - - // ...except when executing function values - } else { - bulk = fn; - fn = function( elem, key, value ) { - return bulk.call( jQuery( elem ), value ); - }; - } - } - - if ( fn ) { - for ( ; i < len; i++ ) { - fn( - elems[ i ], key, raw ? - value : - value.call( elems[ i ], i, fn( elems[ i ], key ) ) - ); - } - } - } - - if ( chainable ) { - return elems; - } - - // Gets - if ( bulk ) { - return fn.call( elems ); - } - - return len ? fn( elems[ 0 ], key ) : emptyGet; -}; -var acceptData = function( owner ) { - - // Accepts only: - // - Node - // - Node.ELEMENT_NODE - // - Node.DOCUMENT_NODE - // - Object - // - Any - return owner.nodeType === 1 || owner.nodeType === 9 || !( +owner.nodeType ); -}; - - - - -function Data() { - this.expando = jQuery.expando + Data.uid++; -} - -Data.uid = 1; - -Data.prototype = { - - cache: function( owner ) { - - // Check if the owner object already has a cache - var value = owner[ this.expando ]; - - // If not, create one - if ( !value ) { - value = {}; - - // We can accept data for non-element nodes in modern browsers, - // but we should not, see #8335. - // Always return an empty object. - if ( acceptData( owner ) ) { - - // If it is a node unlikely to be stringify-ed or looped over - // use plain assignment - if ( owner.nodeType ) { - owner[ this.expando ] = value; - - // Otherwise secure it in a non-enumerable property - // configurable must be true to allow the property to be - // deleted when data is removed - } else { - Object.defineProperty( owner, this.expando, { - value: value, - configurable: true - } ); - } - } - } - - return value; - }, - set: function( owner, data, value ) { - var prop, - cache = this.cache( owner ); - - // Handle: [ owner, key, value ] args - // Always use camelCase key (gh-2257) - if ( typeof data === "string" ) { - cache[ jQuery.camelCase( data ) ] = value; - - // Handle: [ owner, { properties } ] args - } else { - - // Copy the properties one-by-one to the cache object - for ( prop in data ) { - cache[ jQuery.camelCase( prop ) ] = data[ prop ]; - } - } - return cache; - }, - get: function( owner, key ) { - return key === undefined ? - this.cache( owner ) : - - // Always use camelCase key (gh-2257) - owner[ this.expando ] && owner[ this.expando ][ jQuery.camelCase( key ) ]; - }, - access: function( owner, key, value ) { - - // In cases where either: - // - // 1. No key was specified - // 2. A string key was specified, but no value provided - // - // Take the "read" path and allow the get method to determine - // which value to return, respectively either: - // - // 1. The entire cache object - // 2. The data stored at the key - // - if ( key === undefined || - ( ( key && typeof key === "string" ) && value === undefined ) ) { - - return this.get( owner, key ); - } - - // When the key is not a string, or both a key and value - // are specified, set or extend (existing objects) with either: - // - // 1. An object of properties - // 2. A key and value - // - this.set( owner, key, value ); - - // Since the "set" path can have two possible entry points - // return the expected data based on which path was taken[*] - return value !== undefined ? value : key; - }, - remove: function( owner, key ) { - var i, - cache = owner[ this.expando ]; - - if ( cache === undefined ) { - return; - } - - if ( key !== undefined ) { - - // Support array or space separated string of keys - if ( Array.isArray( key ) ) { - - // If key is an array of keys... - // We always set camelCase keys, so remove that. - key = key.map( jQuery.camelCase ); - } else { - key = jQuery.camelCase( key ); - - // If a key with the spaces exists, use it. - // Otherwise, create an array by matching non-whitespace - key = key in cache ? - [ key ] : - ( key.match( rnothtmlwhite ) || [] ); - } - - i = key.length; - - while ( i-- ) { - delete cache[ key[ i ] ]; - } - } - - // Remove the expando if there's no more data - if ( key === undefined || jQuery.isEmptyObject( cache ) ) { - - // Support: Chrome <=35 - 45 - // Webkit & Blink performance suffers when deleting properties - // from DOM nodes, so set to undefined instead - // https://bugs.chromium.org/p/chromium/issues/detail?id=378607 (bug restricted) - if ( owner.nodeType ) { - owner[ this.expando ] = undefined; - } else { - delete owner[ this.expando ]; - } - } - }, - hasData: function( owner ) { - var cache = owner[ this.expando ]; - return cache !== undefined && !jQuery.isEmptyObject( cache ); - } -}; -var dataPriv = new Data(); - -var dataUser = new Data(); - - - -// Implementation Summary -// -// 1. Enforce API surface and semantic compatibility with 1.9.x branch -// 2. Improve the module's maintainability by reducing the storage -// paths to a single mechanism. -// 3. Use the same single mechanism to support "private" and "user" data. -// 4. _Never_ expose "private" data to user code (TODO: Drop _data, _removeData) -// 5. Avoid exposing implementation details on user objects (eg. expando properties) -// 6. Provide a clear path for implementation upgrade to WeakMap in 2014 - -var rbrace = /^(?:\{[\w\W]*\}|\[[\w\W]*\])$/, - rmultiDash = /[A-Z]/g; - -function getData( data ) { - if ( data === "true" ) { - return true; - } - - if ( data === "false" ) { - return false; - } - - if ( data === "null" ) { - return null; - } - - // Only convert to a number if it doesn't change the string - if ( data === +data + "" ) { - return +data; - } - - if ( rbrace.test( data ) ) { - return JSON.parse( data ); - } - - return data; -} - -function dataAttr( elem, key, data ) { - var name; - - // If nothing was found internally, try to fetch any - // data from the HTML5 data-* attribute - if ( data === undefined && elem.nodeType === 1 ) { - name = "data-" + key.replace( rmultiDash, "-$&" ).toLowerCase(); - data = elem.getAttribute( name ); - - if ( typeof data === "string" ) { - try { - data = getData( data ); - } catch ( e ) {} - - // Make sure we set the data so it isn't changed later - dataUser.set( elem, key, data ); - } else { - data = undefined; - } - } - return data; -} - -jQuery.extend( { - hasData: function( elem ) { - return dataUser.hasData( elem ) || dataPriv.hasData( elem ); - }, - - data: function( elem, name, data ) { - return dataUser.access( elem, name, data ); - }, - - removeData: function( elem, name ) { - dataUser.remove( elem, name ); - }, - - // TODO: Now that all calls to _data and _removeData have been replaced - // with direct calls to dataPriv methods, these can be deprecated. - _data: function( elem, name, data ) { - return dataPriv.access( elem, name, data ); - }, - - _removeData: function( elem, name ) { - dataPriv.remove( elem, name ); - } -} ); - -jQuery.fn.extend( { - data: function( key, value ) { - var i, name, data, - elem = this[ 0 ], - attrs = elem && elem.attributes; - - // Gets all values - if ( key === undefined ) { - if ( this.length ) { - data = dataUser.get( elem ); - - if ( elem.nodeType === 1 && !dataPriv.get( elem, "hasDataAttrs" ) ) { - i = attrs.length; - while ( i-- ) { - - // Support: IE 11 only - // The attrs elements can be null (#14894) - if ( attrs[ i ] ) { - name = attrs[ i ].name; - if ( name.indexOf( "data-" ) === 0 ) { - name = jQuery.camelCase( name.slice( 5 ) ); - dataAttr( elem, name, data[ name ] ); - } - } - } - dataPriv.set( elem, "hasDataAttrs", true ); - } - } - - return data; - } - - // Sets multiple values - if ( typeof key === "object" ) { - return this.each( function() { - dataUser.set( this, key ); - } ); - } - - return access( this, function( value ) { - var data; - - // The calling jQuery object (element matches) is not empty - // (and therefore has an element appears at this[ 0 ]) and the - // `value` parameter was not undefined. An empty jQuery object - // will result in `undefined` for elem = this[ 0 ] which will - // throw an exception if an attempt to read a data cache is made. - if ( elem && value === undefined ) { - - // Attempt to get data from the cache - // The key will always be camelCased in Data - data = dataUser.get( elem, key ); - if ( data !== undefined ) { - return data; - } - - // Attempt to "discover" the data in - // HTML5 custom data-* attrs - data = dataAttr( elem, key ); - if ( data !== undefined ) { - return data; - } - - // We tried really hard, but the data doesn't exist. - return; - } - - // Set the data... - this.each( function() { - - // We always store the camelCased key - dataUser.set( this, key, value ); - } ); - }, null, value, arguments.length > 1, null, true ); - }, - - removeData: function( key ) { - return this.each( function() { - dataUser.remove( this, key ); - } ); - } -} ); - - -jQuery.extend( { - queue: function( elem, type, data ) { - var queue; - - if ( elem ) { - type = ( type || "fx" ) + "queue"; - queue = dataPriv.get( elem, type ); - - // Speed up dequeue by getting out quickly if this is just a lookup - if ( data ) { - if ( !queue || Array.isArray( data ) ) { - queue = dataPriv.access( elem, type, jQuery.makeArray( data ) ); - } else { - queue.push( data ); - } - } - return queue || []; - } - }, - - dequeue: function( elem, type ) { - type = type || "fx"; - - var queue = jQuery.queue( elem, type ), - startLength = queue.length, - fn = queue.shift(), - hooks = jQuery._queueHooks( elem, type ), - next = function() { - jQuery.dequeue( elem, type ); - }; - - // If the fx queue is dequeued, always remove the progress sentinel - if ( fn === "inprogress" ) { - fn = queue.shift(); - startLength--; - } - - if ( fn ) { - - // Add a progress sentinel to prevent the fx queue from being - // automatically dequeued - if ( type === "fx" ) { - queue.unshift( "inprogress" ); - } - - // Clear up the last queue stop function - delete hooks.stop; - fn.call( elem, next, hooks ); - } - - if ( !startLength && hooks ) { - hooks.empty.fire(); - } - }, - - // Not public - generate a queueHooks object, or return the current one - _queueHooks: function( elem, type ) { - var key = type + "queueHooks"; - return dataPriv.get( elem, key ) || dataPriv.access( elem, key, { - empty: jQuery.Callbacks( "once memory" ).add( function() { - dataPriv.remove( elem, [ type + "queue", key ] ); - } ) - } ); - } -} ); - -jQuery.fn.extend( { - queue: function( type, data ) { - var setter = 2; - - if ( typeof type !== "string" ) { - data = type; - type = "fx"; - setter--; - } - - if ( arguments.length < setter ) { - return jQuery.queue( this[ 0 ], type ); - } - - return data === undefined ? - this : - this.each( function() { - var queue = jQuery.queue( this, type, data ); - - // Ensure a hooks for this queue - jQuery._queueHooks( this, type ); - - if ( type === "fx" && queue[ 0 ] !== "inprogress" ) { - jQuery.dequeue( this, type ); - } - } ); - }, - dequeue: function( type ) { - return this.each( function() { - jQuery.dequeue( this, type ); - } ); - }, - clearQueue: function( type ) { - return this.queue( type || "fx", [] ); - }, - - // Get a promise resolved when queues of a certain type - // are emptied (fx is the type by default) - promise: function( type, obj ) { - var tmp, - count = 1, - defer = jQuery.Deferred(), - elements = this, - i = this.length, - resolve = function() { - if ( !( --count ) ) { - defer.resolveWith( elements, [ elements ] ); - } - }; - - if ( typeof type !== "string" ) { - obj = type; - type = undefined; - } - type = type || "fx"; - - while ( i-- ) { - tmp = dataPriv.get( elements[ i ], type + "queueHooks" ); - if ( tmp && tmp.empty ) { - count++; - tmp.empty.add( resolve ); - } - } - resolve(); - return defer.promise( obj ); - } -} ); -var pnum = ( /[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/ ).source; - -var rcssNum = new RegExp( "^(?:([+-])=|)(" + pnum + ")([a-z%]*)$", "i" ); - - -var cssExpand = [ "Top", "Right", "Bottom", "Left" ]; - -var isHiddenWithinTree = function( elem, el ) { - - // isHiddenWithinTree might be called from jQuery#filter function; - // in that case, element will be second argument - elem = el || elem; - - // Inline style trumps all - return elem.style.display === "none" || - elem.style.display === "" && - - // Otherwise, check computed style - // Support: Firefox <=43 - 45 - // Disconnected elements can have computed display: none, so first confirm that elem is - // in the document. - jQuery.contains( elem.ownerDocument, elem ) && - - jQuery.css( elem, "display" ) === "none"; - }; - -var swap = function( elem, options, callback, args ) { - var ret, name, - old = {}; - - // Remember the old values, and insert the new ones - for ( name in options ) { - old[ name ] = elem.style[ name ]; - elem.style[ name ] = options[ name ]; - } - - ret = callback.apply( elem, args || [] ); - - // Revert the old values - for ( name in options ) { - elem.style[ name ] = old[ name ]; - } - - return ret; -}; - - - - -function adjustCSS( elem, prop, valueParts, tween ) { - var adjusted, - scale = 1, - maxIterations = 20, - currentValue = tween ? - function() { - return tween.cur(); - } : - function() { - return jQuery.css( elem, prop, "" ); - }, - initial = currentValue(), - unit = valueParts && valueParts[ 3 ] || ( jQuery.cssNumber[ prop ] ? "" : "px" ), - - // Starting value computation is required for potential unit mismatches - initialInUnit = ( jQuery.cssNumber[ prop ] || unit !== "px" && +initial ) && - rcssNum.exec( jQuery.css( elem, prop ) ); - - if ( initialInUnit && initialInUnit[ 3 ] !== unit ) { - - // Trust units reported by jQuery.css - unit = unit || initialInUnit[ 3 ]; - - // Make sure we update the tween properties later on - valueParts = valueParts || []; - - // Iteratively approximate from a nonzero starting point - initialInUnit = +initial || 1; - - do { - - // If previous iteration zeroed out, double until we get *something*. - // Use string for doubling so we don't accidentally see scale as unchanged below - scale = scale || ".5"; - - // Adjust and apply - initialInUnit = initialInUnit / scale; - jQuery.style( elem, prop, initialInUnit + unit ); - - // Update scale, tolerating zero or NaN from tween.cur() - // Break the loop if scale is unchanged or perfect, or if we've just had enough. - } while ( - scale !== ( scale = currentValue() / initial ) && scale !== 1 && --maxIterations - ); - } - - if ( valueParts ) { - initialInUnit = +initialInUnit || +initial || 0; - - // Apply relative offset (+=/-=) if specified - adjusted = valueParts[ 1 ] ? - initialInUnit + ( valueParts[ 1 ] + 1 ) * valueParts[ 2 ] : - +valueParts[ 2 ]; - if ( tween ) { - tween.unit = unit; - tween.start = initialInUnit; - tween.end = adjusted; - } - } - return adjusted; -} - - -var defaultDisplayMap = {}; - -function getDefaultDisplay( elem ) { - var temp, - doc = elem.ownerDocument, - nodeName = elem.nodeName, - display = defaultDisplayMap[ nodeName ]; - - if ( display ) { - return display; - } - - temp = doc.body.appendChild( doc.createElement( nodeName ) ); - display = jQuery.css( temp, "display" ); - - temp.parentNode.removeChild( temp ); - - if ( display === "none" ) { - display = "block"; - } - defaultDisplayMap[ nodeName ] = display; - - return display; -} - -function showHide( elements, show ) { - var display, elem, - values = [], - index = 0, - length = elements.length; - - // Determine new display value for elements that need to change - for ( ; index < length; index++ ) { - elem = elements[ index ]; - if ( !elem.style ) { - continue; - } - - display = elem.style.display; - if ( show ) { - - // Since we force visibility upon cascade-hidden elements, an immediate (and slow) - // check is required in this first loop unless we have a nonempty display value (either - // inline or about-to-be-restored) - if ( display === "none" ) { - values[ index ] = dataPriv.get( elem, "display" ) || null; - if ( !values[ index ] ) { - elem.style.display = ""; - } - } - if ( elem.style.display === "" && isHiddenWithinTree( elem ) ) { - values[ index ] = getDefaultDisplay( elem ); - } - } else { - if ( display !== "none" ) { - values[ index ] = "none"; - - // Remember what we're overwriting - dataPriv.set( elem, "display", display ); - } - } - } - - // Set the display of the elements in a second loop to avoid constant reflow - for ( index = 0; index < length; index++ ) { - if ( values[ index ] != null ) { - elements[ index ].style.display = values[ index ]; - } - } - - return elements; -} - -jQuery.fn.extend( { - show: function() { - return showHide( this, true ); - }, - hide: function() { - return showHide( this ); - }, - toggle: function( state ) { - if ( typeof state === "boolean" ) { - return state ? this.show() : this.hide(); - } - - return this.each( function() { - if ( isHiddenWithinTree( this ) ) { - jQuery( this ).show(); - } else { - jQuery( this ).hide(); - } - } ); - } -} ); -var rcheckableType = ( /^(?:checkbox|radio)$/i ); - -var rtagName = ( /<([a-z][^\/\0>\x20\t\r\n\f]+)/i ); - -var rscriptType = ( /^$|\/(?:java|ecma)script/i ); - - - -// We have to close these tags to support XHTML (#13200) -var wrapMap = { - - // Support: IE <=9 only - option: [ 1, "" ], - - // XHTML parsers do not magically insert elements in the - // same way that tag soup parsers do. So we cannot shorten - // this by omitting or other required elements. - thead: [ 1, "", "
" ], - col: [ 2, "", "
" ], - tr: [ 2, "", "
" ], - td: [ 3, "", "
" ], - - _default: [ 0, "", "" ] -}; - -// Support: IE <=9 only -wrapMap.optgroup = wrapMap.option; - -wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead; -wrapMap.th = wrapMap.td; - - -function getAll( context, tag ) { - - // Support: IE <=9 - 11 only - // Use typeof to avoid zero-argument method invocation on host objects (#15151) - var ret; - - if ( typeof context.getElementsByTagName !== "undefined" ) { - ret = context.getElementsByTagName( tag || "*" ); - - } else if ( typeof context.querySelectorAll !== "undefined" ) { - ret = context.querySelectorAll( tag || "*" ); - - } else { - ret = []; - } - - if ( tag === undefined || tag && nodeName( context, tag ) ) { - return jQuery.merge( [ context ], ret ); - } - - return ret; -} - - -// Mark scripts as having already been evaluated -function setGlobalEval( elems, refElements ) { - var i = 0, - l = elems.length; - - for ( ; i < l; i++ ) { - dataPriv.set( - elems[ i ], - "globalEval", - !refElements || dataPriv.get( refElements[ i ], "globalEval" ) - ); - } -} - - -var rhtml = /<|&#?\w+;/; - -function buildFragment( elems, context, scripts, selection, ignored ) { - var elem, tmp, tag, wrap, contains, j, - fragment = context.createDocumentFragment(), - nodes = [], - i = 0, - l = elems.length; - - for ( ; i < l; i++ ) { - elem = elems[ i ]; - - if ( elem || elem === 0 ) { - - // Add nodes directly - if ( jQuery.type( elem ) === "object" ) { - - // Support: Android <=4.0 only, PhantomJS 1 only - // push.apply(_, arraylike) throws on ancient WebKit - jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem ); - - // Convert non-html into a text node - } else if ( !rhtml.test( elem ) ) { - nodes.push( context.createTextNode( elem ) ); - - // Convert html into DOM nodes - } else { - tmp = tmp || fragment.appendChild( context.createElement( "div" ) ); - - // Deserialize a standard representation - tag = ( rtagName.exec( elem ) || [ "", "" ] )[ 1 ].toLowerCase(); - wrap = wrapMap[ tag ] || wrapMap._default; - tmp.innerHTML = wrap[ 1 ] + jQuery.htmlPrefilter( elem ) + wrap[ 2 ]; - - // Descend through wrappers to the right content - j = wrap[ 0 ]; - while ( j-- ) { - tmp = tmp.lastChild; - } - - // Support: Android <=4.0 only, PhantomJS 1 only - // push.apply(_, arraylike) throws on ancient WebKit - jQuery.merge( nodes, tmp.childNodes ); - - // Remember the top-level container - tmp = fragment.firstChild; - - // Ensure the created nodes are orphaned (#12392) - tmp.textContent = ""; - } - } - } - - // Remove wrapper from fragment - fragment.textContent = ""; - - i = 0; - while ( ( elem = nodes[ i++ ] ) ) { - - // Skip elements already in the context collection (trac-4087) - if ( selection && jQuery.inArray( elem, selection ) > -1 ) { - if ( ignored ) { - ignored.push( elem ); - } - continue; - } - - contains = jQuery.contains( elem.ownerDocument, elem ); - - // Append to fragment - tmp = getAll( fragment.appendChild( elem ), "script" ); - - // Preserve script evaluation history - if ( contains ) { - setGlobalEval( tmp ); - } - - // Capture executables - if ( scripts ) { - j = 0; - while ( ( elem = tmp[ j++ ] ) ) { - if ( rscriptType.test( elem.type || "" ) ) { - scripts.push( elem ); - } - } - } - } - - return fragment; -} - - -( function() { - var fragment = document.createDocumentFragment(), - div = fragment.appendChild( document.createElement( "div" ) ), - input = document.createElement( "input" ); - - // Support: Android 4.0 - 4.3 only - // Check state lost if the name is set (#11217) - // Support: Windows Web Apps (WWA) - // `name` and `type` must use .setAttribute for WWA (#14901) - input.setAttribute( "type", "radio" ); - input.setAttribute( "checked", "checked" ); - input.setAttribute( "name", "t" ); - - div.appendChild( input ); - - // Support: Android <=4.1 only - // Older WebKit doesn't clone checked state correctly in fragments - support.checkClone = div.cloneNode( true ).cloneNode( true ).lastChild.checked; - - // Support: IE <=11 only - // Make sure textarea (and checkbox) defaultValue is properly cloned - div.innerHTML = ""; - support.noCloneChecked = !!div.cloneNode( true ).lastChild.defaultValue; -} )(); -var documentElement = document.documentElement; - - - -var - rkeyEvent = /^key/, - rmouseEvent = /^(?:mouse|pointer|contextmenu|drag|drop)|click/, - rtypenamespace = /^([^.]*)(?:\.(.+)|)/; - -function returnTrue() { - return true; -} - -function returnFalse() { - return false; -} - -// Support: IE <=9 only -// See #13393 for more info -function safeActiveElement() { - try { - return document.activeElement; - } catch ( err ) { } -} - -function on( elem, types, selector, data, fn, one ) { - var origFn, type; - - // Types can be a map of types/handlers - if ( typeof types === "object" ) { - - // ( types-Object, selector, data ) - if ( typeof selector !== "string" ) { - - // ( types-Object, data ) - data = data || selector; - selector = undefined; - } - for ( type in types ) { - on( elem, type, selector, data, types[ type ], one ); - } - return elem; - } - - if ( data == null && fn == null ) { - - // ( types, fn ) - fn = selector; - data = selector = undefined; - } else if ( fn == null ) { - if ( typeof selector === "string" ) { - - // ( types, selector, fn ) - fn = data; - data = undefined; - } else { - - // ( types, data, fn ) - fn = data; - data = selector; - selector = undefined; - } - } - if ( fn === false ) { - fn = returnFalse; - } else if ( !fn ) { - return elem; - } - - if ( one === 1 ) { - origFn = fn; - fn = function( event ) { - - // Can use an empty set, since event contains the info - jQuery().off( event ); - return origFn.apply( this, arguments ); - }; - - // Use same guid so caller can remove using origFn - fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ ); - } - return elem.each( function() { - jQuery.event.add( this, types, fn, data, selector ); - } ); -} - -/* - * Helper functions for managing events -- not part of the public interface. - * Props to Dean Edwards' addEvent library for many of the ideas. - */ -jQuery.event = { - - global: {}, - - add: function( elem, types, handler, data, selector ) { - - var handleObjIn, eventHandle, tmp, - events, t, handleObj, - special, handlers, type, namespaces, origType, - elemData = dataPriv.get( elem ); - - // Don't attach events to noData or text/comment nodes (but allow plain objects) - if ( !elemData ) { - return; - } - - // Caller can pass in an object of custom data in lieu of the handler - if ( handler.handler ) { - handleObjIn = handler; - handler = handleObjIn.handler; - selector = handleObjIn.selector; - } - - // Ensure that invalid selectors throw exceptions at attach time - // Evaluate against documentElement in case elem is a non-element node (e.g., document) - if ( selector ) { - jQuery.find.matchesSelector( documentElement, selector ); - } - - // Make sure that the handler has a unique ID, used to find/remove it later - if ( !handler.guid ) { - handler.guid = jQuery.guid++; - } - - // Init the element's event structure and main handler, if this is the first - if ( !( events = elemData.events ) ) { - events = elemData.events = {}; - } - if ( !( eventHandle = elemData.handle ) ) { - eventHandle = elemData.handle = function( e ) { - - // Discard the second event of a jQuery.event.trigger() and - // when an event is called after a page has unloaded - return typeof jQuery !== "undefined" && jQuery.event.triggered !== e.type ? - jQuery.event.dispatch.apply( elem, arguments ) : undefined; - }; - } - - // Handle multiple events separated by a space - types = ( types || "" ).match( rnothtmlwhite ) || [ "" ]; - t = types.length; - while ( t-- ) { - tmp = rtypenamespace.exec( types[ t ] ) || []; - type = origType = tmp[ 1 ]; - namespaces = ( tmp[ 2 ] || "" ).split( "." ).sort(); - - // There *must* be a type, no attaching namespace-only handlers - if ( !type ) { - continue; - } - - // If event changes its type, use the special event handlers for the changed type - special = jQuery.event.special[ type ] || {}; - - // If selector defined, determine special event api type, otherwise given type - type = ( selector ? special.delegateType : special.bindType ) || type; - - // Update special based on newly reset type - special = jQuery.event.special[ type ] || {}; - - // handleObj is passed to all event handlers - handleObj = jQuery.extend( { - type: type, - origType: origType, - data: data, - handler: handler, - guid: handler.guid, - selector: selector, - needsContext: selector && jQuery.expr.match.needsContext.test( selector ), - namespace: namespaces.join( "." ) - }, handleObjIn ); - - // Init the event handler queue if we're the first - if ( !( handlers = events[ type ] ) ) { - handlers = events[ type ] = []; - handlers.delegateCount = 0; - - // Only use addEventListener if the special events handler returns false - if ( !special.setup || - special.setup.call( elem, data, namespaces, eventHandle ) === false ) { - - if ( elem.addEventListener ) { - elem.addEventListener( type, eventHandle ); - } - } - } - - if ( special.add ) { - special.add.call( elem, handleObj ); - - if ( !handleObj.handler.guid ) { - handleObj.handler.guid = handler.guid; - } - } - - // Add to the element's handler list, delegates in front - if ( selector ) { - handlers.splice( handlers.delegateCount++, 0, handleObj ); - } else { - handlers.push( handleObj ); - } - - // Keep track of which events have ever been used, for event optimization - jQuery.event.global[ type ] = true; - } - - }, - - // Detach an event or set of events from an element - remove: function( elem, types, handler, selector, mappedTypes ) { - - var j, origCount, tmp, - events, t, handleObj, - special, handlers, type, namespaces, origType, - elemData = dataPriv.hasData( elem ) && dataPriv.get( elem ); - - if ( !elemData || !( events = elemData.events ) ) { - return; - } - - // Once for each type.namespace in types; type may be omitted - types = ( types || "" ).match( rnothtmlwhite ) || [ "" ]; - t = types.length; - while ( t-- ) { - tmp = rtypenamespace.exec( types[ t ] ) || []; - type = origType = tmp[ 1 ]; - namespaces = ( tmp[ 2 ] || "" ).split( "." ).sort(); - - // Unbind all events (on this namespace, if provided) for the element - if ( !type ) { - for ( type in events ) { - jQuery.event.remove( elem, type + types[ t ], handler, selector, true ); - } - continue; - } - - special = jQuery.event.special[ type ] || {}; - type = ( selector ? special.delegateType : special.bindType ) || type; - handlers = events[ type ] || []; - tmp = tmp[ 2 ] && - new RegExp( "(^|\\.)" + namespaces.join( "\\.(?:.*\\.|)" ) + "(\\.|$)" ); - - // Remove matching events - origCount = j = handlers.length; - while ( j-- ) { - handleObj = handlers[ j ]; - - if ( ( mappedTypes || origType === handleObj.origType ) && - ( !handler || handler.guid === handleObj.guid ) && - ( !tmp || tmp.test( handleObj.namespace ) ) && - ( !selector || selector === handleObj.selector || - selector === "**" && handleObj.selector ) ) { - handlers.splice( j, 1 ); - - if ( handleObj.selector ) { - handlers.delegateCount--; - } - if ( special.remove ) { - special.remove.call( elem, handleObj ); - } - } - } - - // Remove generic event handler if we removed something and no more handlers exist - // (avoids potential for endless recursion during removal of special event handlers) - if ( origCount && !handlers.length ) { - if ( !special.teardown || - special.teardown.call( elem, namespaces, elemData.handle ) === false ) { - - jQuery.removeEvent( elem, type, elemData.handle ); - } - - delete events[ type ]; - } - } - - // Remove data and the expando if it's no longer used - if ( jQuery.isEmptyObject( events ) ) { - dataPriv.remove( elem, "handle events" ); - } - }, - - dispatch: function( nativeEvent ) { - - // Make a writable jQuery.Event from the native event object - var event = jQuery.event.fix( nativeEvent ); - - var i, j, ret, matched, handleObj, handlerQueue, - args = new Array( arguments.length ), - handlers = ( dataPriv.get( this, "events" ) || {} )[ event.type ] || [], - special = jQuery.event.special[ event.type ] || {}; - - // Use the fix-ed jQuery.Event rather than the (read-only) native event - args[ 0 ] = event; - - for ( i = 1; i < arguments.length; i++ ) { - args[ i ] = arguments[ i ]; - } - - event.delegateTarget = this; - - // Call the preDispatch hook for the mapped type, and let it bail if desired - if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) { - return; - } - - // Determine handlers - handlerQueue = jQuery.event.handlers.call( this, event, handlers ); - - // Run delegates first; they may want to stop propagation beneath us - i = 0; - while ( ( matched = handlerQueue[ i++ ] ) && !event.isPropagationStopped() ) { - event.currentTarget = matched.elem; - - j = 0; - while ( ( handleObj = matched.handlers[ j++ ] ) && - !event.isImmediatePropagationStopped() ) { - - // Triggered event must either 1) have no namespace, or 2) have namespace(s) - // a subset or equal to those in the bound event (both can have no namespace). - if ( !event.rnamespace || event.rnamespace.test( handleObj.namespace ) ) { - - event.handleObj = handleObj; - event.data = handleObj.data; - - ret = ( ( jQuery.event.special[ handleObj.origType ] || {} ).handle || - handleObj.handler ).apply( matched.elem, args ); - - if ( ret !== undefined ) { - if ( ( event.result = ret ) === false ) { - event.preventDefault(); - event.stopPropagation(); - } - } - } - } - } - - // Call the postDispatch hook for the mapped type - if ( special.postDispatch ) { - special.postDispatch.call( this, event ); - } - - return event.result; - }, - - handlers: function( event, handlers ) { - var i, handleObj, sel, matchedHandlers, matchedSelectors, - handlerQueue = [], - delegateCount = handlers.delegateCount, - cur = event.target; - - // Find delegate handlers - if ( delegateCount && - - // Support: IE <=9 - // Black-hole SVG instance trees (trac-13180) - cur.nodeType && - - // Support: Firefox <=42 - // Suppress spec-violating clicks indicating a non-primary pointer button (trac-3861) - // https://www.w3.org/TR/DOM-Level-3-Events/#event-type-click - // Support: IE 11 only - // ...but not arrow key "clicks" of radio inputs, which can have `button` -1 (gh-2343) - !( event.type === "click" && event.button >= 1 ) ) { - - for ( ; cur !== this; cur = cur.parentNode || this ) { - - // Don't check non-elements (#13208) - // Don't process clicks on disabled elements (#6911, #8165, #11382, #11764) - if ( cur.nodeType === 1 && !( event.type === "click" && cur.disabled === true ) ) { - matchedHandlers = []; - matchedSelectors = {}; - for ( i = 0; i < delegateCount; i++ ) { - handleObj = handlers[ i ]; - - // Don't conflict with Object.prototype properties (#13203) - sel = handleObj.selector + " "; - - if ( matchedSelectors[ sel ] === undefined ) { - matchedSelectors[ sel ] = handleObj.needsContext ? - jQuery( sel, this ).index( cur ) > -1 : - jQuery.find( sel, this, null, [ cur ] ).length; - } - if ( matchedSelectors[ sel ] ) { - matchedHandlers.push( handleObj ); - } - } - if ( matchedHandlers.length ) { - handlerQueue.push( { elem: cur, handlers: matchedHandlers } ); - } - } - } - } - - // Add the remaining (directly-bound) handlers - cur = this; - if ( delegateCount < handlers.length ) { - handlerQueue.push( { elem: cur, handlers: handlers.slice( delegateCount ) } ); - } - - return handlerQueue; - }, - - addProp: function( name, hook ) { - Object.defineProperty( jQuery.Event.prototype, name, { - enumerable: true, - configurable: true, - - get: jQuery.isFunction( hook ) ? - function() { - if ( this.originalEvent ) { - return hook( this.originalEvent ); - } - } : - function() { - if ( this.originalEvent ) { - return this.originalEvent[ name ]; - } - }, - - set: function( value ) { - Object.defineProperty( this, name, { - enumerable: true, - configurable: true, - writable: true, - value: value - } ); - } - } ); - }, - - fix: function( originalEvent ) { - return originalEvent[ jQuery.expando ] ? - originalEvent : - new jQuery.Event( originalEvent ); - }, - - special: { - load: { - - // Prevent triggered image.load events from bubbling to window.load - noBubble: true - }, - focus: { - - // Fire native event if possible so blur/focus sequence is correct - trigger: function() { - if ( this !== safeActiveElement() && this.focus ) { - this.focus(); - return false; - } - }, - delegateType: "focusin" - }, - blur: { - trigger: function() { - if ( this === safeActiveElement() && this.blur ) { - this.blur(); - return false; - } - }, - delegateType: "focusout" - }, - click: { - - // For checkbox, fire native event so checked state will be right - trigger: function() { - if ( this.type === "checkbox" && this.click && nodeName( this, "input" ) ) { - this.click(); - return false; - } - }, - - // For cross-browser consistency, don't fire native .click() on links - _default: function( event ) { - return nodeName( event.target, "a" ); - } - }, - - beforeunload: { - postDispatch: function( event ) { - - // Support: Firefox 20+ - // Firefox doesn't alert if the returnValue field is not set. - if ( event.result !== undefined && event.originalEvent ) { - event.originalEvent.returnValue = event.result; - } - } - } - } -}; - -jQuery.removeEvent = function( elem, type, handle ) { - - // This "if" is needed for plain objects - if ( elem.removeEventListener ) { - elem.removeEventListener( type, handle ); - } -}; - -jQuery.Event = function( src, props ) { - - // Allow instantiation without the 'new' keyword - if ( !( this instanceof jQuery.Event ) ) { - return new jQuery.Event( src, props ); - } - - // Event object - if ( src && src.type ) { - this.originalEvent = src; - this.type = src.type; - - // Events bubbling up the document may have been marked as prevented - // by a handler lower down the tree; reflect the correct value. - this.isDefaultPrevented = src.defaultPrevented || - src.defaultPrevented === undefined && - - // Support: Android <=2.3 only - src.returnValue === false ? - returnTrue : - returnFalse; - - // Create target properties - // Support: Safari <=6 - 7 only - // Target should not be a text node (#504, #13143) - this.target = ( src.target && src.target.nodeType === 3 ) ? - src.target.parentNode : - src.target; - - this.currentTarget = src.currentTarget; - this.relatedTarget = src.relatedTarget; - - // Event type - } else { - this.type = src; - } - - // Put explicitly provided properties onto the event object - if ( props ) { - jQuery.extend( this, props ); - } - - // Create a timestamp if incoming event doesn't have one - this.timeStamp = src && src.timeStamp || jQuery.now(); - - // Mark it as fixed - this[ jQuery.expando ] = true; -}; - -// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding -// https://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html -jQuery.Event.prototype = { - constructor: jQuery.Event, - isDefaultPrevented: returnFalse, - isPropagationStopped: returnFalse, - isImmediatePropagationStopped: returnFalse, - isSimulated: false, - - preventDefault: function() { - var e = this.originalEvent; - - this.isDefaultPrevented = returnTrue; - - if ( e && !this.isSimulated ) { - e.preventDefault(); - } - }, - stopPropagation: function() { - var e = this.originalEvent; - - this.isPropagationStopped = returnTrue; - - if ( e && !this.isSimulated ) { - e.stopPropagation(); - } - }, - stopImmediatePropagation: function() { - var e = this.originalEvent; - - this.isImmediatePropagationStopped = returnTrue; - - if ( e && !this.isSimulated ) { - e.stopImmediatePropagation(); - } - - this.stopPropagation(); - } -}; - -// Includes all common event props including KeyEvent and MouseEvent specific props -jQuery.each( { - altKey: true, - bubbles: true, - cancelable: true, - changedTouches: true, - ctrlKey: true, - detail: true, - eventPhase: true, - metaKey: true, - pageX: true, - pageY: true, - shiftKey: true, - view: true, - "char": true, - charCode: true, - key: true, - keyCode: true, - button: true, - buttons: true, - clientX: true, - clientY: true, - offsetX: true, - offsetY: true, - pointerId: true, - pointerType: true, - screenX: true, - screenY: true, - targetTouches: true, - toElement: true, - touches: true, - - which: function( event ) { - var button = event.button; - - // Add which for key events - if ( event.which == null && rkeyEvent.test( event.type ) ) { - return event.charCode != null ? event.charCode : event.keyCode; - } - - // Add which for click: 1 === left; 2 === middle; 3 === right - if ( !event.which && button !== undefined && rmouseEvent.test( event.type ) ) { - if ( button & 1 ) { - return 1; - } - - if ( button & 2 ) { - return 3; - } - - if ( button & 4 ) { - return 2; - } - - return 0; - } - - return event.which; - } -}, jQuery.event.addProp ); - -// Create mouseenter/leave events using mouseover/out and event-time checks -// so that event delegation works in jQuery. -// Do the same for pointerenter/pointerleave and pointerover/pointerout -// -// Support: Safari 7 only -// Safari sends mouseenter too often; see: -// https://bugs.chromium.org/p/chromium/issues/detail?id=470258 -// for the description of the bug (it existed in older Chrome versions as well). -jQuery.each( { - mouseenter: "mouseover", - mouseleave: "mouseout", - pointerenter: "pointerover", - pointerleave: "pointerout" -}, function( orig, fix ) { - jQuery.event.special[ orig ] = { - delegateType: fix, - bindType: fix, - - handle: function( event ) { - var ret, - target = this, - related = event.relatedTarget, - handleObj = event.handleObj; - - // For mouseenter/leave call the handler if related is outside the target. - // NB: No relatedTarget if the mouse left/entered the browser window - if ( !related || ( related !== target && !jQuery.contains( target, related ) ) ) { - event.type = handleObj.origType; - ret = handleObj.handler.apply( this, arguments ); - event.type = fix; - } - return ret; - } - }; -} ); - -jQuery.fn.extend( { - - on: function( types, selector, data, fn ) { - return on( this, types, selector, data, fn ); - }, - one: function( types, selector, data, fn ) { - return on( this, types, selector, data, fn, 1 ); - }, - off: function( types, selector, fn ) { - var handleObj, type; - if ( types && types.preventDefault && types.handleObj ) { - - // ( event ) dispatched jQuery.Event - handleObj = types.handleObj; - jQuery( types.delegateTarget ).off( - handleObj.namespace ? - handleObj.origType + "." + handleObj.namespace : - handleObj.origType, - handleObj.selector, - handleObj.handler - ); - return this; - } - if ( typeof types === "object" ) { - - // ( types-object [, selector] ) - for ( type in types ) { - this.off( type, selector, types[ type ] ); - } - return this; - } - if ( selector === false || typeof selector === "function" ) { - - // ( types [, fn] ) - fn = selector; - selector = undefined; - } - if ( fn === false ) { - fn = returnFalse; - } - return this.each( function() { - jQuery.event.remove( this, types, fn, selector ); - } ); - } -} ); - - -var - - /* eslint-disable max-len */ - - // See https://github.com/eslint/eslint/issues/3229 - rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([a-z][^\/\0>\x20\t\r\n\f]*)[^>]*)\/>/gi, - - /* eslint-enable */ - - // Support: IE <=10 - 11, Edge 12 - 13 - // In IE/Edge using regex groups here causes severe slowdowns. - // See https://connect.microsoft.com/IE/feedback/details/1736512/ - rnoInnerhtml = /\s*$/g; - -// Prefer a tbody over its parent table for containing new rows -function manipulationTarget( elem, content ) { - if ( nodeName( elem, "table" ) && - nodeName( content.nodeType !== 11 ? content : content.firstChild, "tr" ) ) { - - return jQuery( ">tbody", elem )[ 0 ] || elem; - } - - return elem; -} - -// Replace/restore the type attribute of script elements for safe DOM manipulation -function disableScript( elem ) { - elem.type = ( elem.getAttribute( "type" ) !== null ) + "/" + elem.type; - return elem; -} -function restoreScript( elem ) { - var match = rscriptTypeMasked.exec( elem.type ); - - if ( match ) { - elem.type = match[ 1 ]; - } else { - elem.removeAttribute( "type" ); - } - - return elem; -} - -function cloneCopyEvent( src, dest ) { - var i, l, type, pdataOld, pdataCur, udataOld, udataCur, events; - - if ( dest.nodeType !== 1 ) { - return; - } - - // 1. Copy private data: events, handlers, etc. - if ( dataPriv.hasData( src ) ) { - pdataOld = dataPriv.access( src ); - pdataCur = dataPriv.set( dest, pdataOld ); - events = pdataOld.events; - - if ( events ) { - delete pdataCur.handle; - pdataCur.events = {}; - - for ( type in events ) { - for ( i = 0, l = events[ type ].length; i < l; i++ ) { - jQuery.event.add( dest, type, events[ type ][ i ] ); - } - } - } - } - - // 2. Copy user data - if ( dataUser.hasData( src ) ) { - udataOld = dataUser.access( src ); - udataCur = jQuery.extend( {}, udataOld ); - - dataUser.set( dest, udataCur ); - } -} - -// Fix IE bugs, see support tests -function fixInput( src, dest ) { - var nodeName = dest.nodeName.toLowerCase(); - - // Fails to persist the checked state of a cloned checkbox or radio button. - if ( nodeName === "input" && rcheckableType.test( src.type ) ) { - dest.checked = src.checked; - - // Fails to return the selected option to the default selected state when cloning options - } else if ( nodeName === "input" || nodeName === "textarea" ) { - dest.defaultValue = src.defaultValue; - } -} - -function domManip( collection, args, callback, ignored ) { - - // Flatten any nested arrays - args = concat.apply( [], args ); - - var fragment, first, scripts, hasScripts, node, doc, - i = 0, - l = collection.length, - iNoClone = l - 1, - value = args[ 0 ], - isFunction = jQuery.isFunction( value ); - - // We can't cloneNode fragments that contain checked, in WebKit - if ( isFunction || - ( l > 1 && typeof value === "string" && - !support.checkClone && rchecked.test( value ) ) ) { - return collection.each( function( index ) { - var self = collection.eq( index ); - if ( isFunction ) { - args[ 0 ] = value.call( this, index, self.html() ); - } - domManip( self, args, callback, ignored ); - } ); - } - - if ( l ) { - fragment = buildFragment( args, collection[ 0 ].ownerDocument, false, collection, ignored ); - first = fragment.firstChild; - - if ( fragment.childNodes.length === 1 ) { - fragment = first; - } - - // Require either new content or an interest in ignored elements to invoke the callback - if ( first || ignored ) { - scripts = jQuery.map( getAll( fragment, "script" ), disableScript ); - hasScripts = scripts.length; - - // Use the original fragment for the last item - // instead of the first because it can end up - // being emptied incorrectly in certain situations (#8070). - for ( ; i < l; i++ ) { - node = fragment; - - if ( i !== iNoClone ) { - node = jQuery.clone( node, true, true ); - - // Keep references to cloned scripts for later restoration - if ( hasScripts ) { - - // Support: Android <=4.0 only, PhantomJS 1 only - // push.apply(_, arraylike) throws on ancient WebKit - jQuery.merge( scripts, getAll( node, "script" ) ); - } - } - - callback.call( collection[ i ], node, i ); - } - - if ( hasScripts ) { - doc = scripts[ scripts.length - 1 ].ownerDocument; - - // Reenable scripts - jQuery.map( scripts, restoreScript ); - - // Evaluate executable scripts on first document insertion - for ( i = 0; i < hasScripts; i++ ) { - node = scripts[ i ]; - if ( rscriptType.test( node.type || "" ) && - !dataPriv.access( node, "globalEval" ) && - jQuery.contains( doc, node ) ) { - - if ( node.src ) { - - // Optional AJAX dependency, but won't run scripts if not present - if ( jQuery._evalUrl ) { - jQuery._evalUrl( node.src ); - } - } else { - DOMEval( node.textContent.replace( rcleanScript, "" ), doc ); - } - } - } - } - } - } - - return collection; -} - -function remove( elem, selector, keepData ) { - var node, - nodes = selector ? jQuery.filter( selector, elem ) : elem, - i = 0; - - for ( ; ( node = nodes[ i ] ) != null; i++ ) { - if ( !keepData && node.nodeType === 1 ) { - jQuery.cleanData( getAll( node ) ); - } - - if ( node.parentNode ) { - if ( keepData && jQuery.contains( node.ownerDocument, node ) ) { - setGlobalEval( getAll( node, "script" ) ); - } - node.parentNode.removeChild( node ); - } - } - - return elem; -} - -jQuery.extend( { - htmlPrefilter: function( html ) { - return html.replace( rxhtmlTag, "<$1>" ); - }, - - clone: function( elem, dataAndEvents, deepDataAndEvents ) { - var i, l, srcElements, destElements, - clone = elem.cloneNode( true ), - inPage = jQuery.contains( elem.ownerDocument, elem ); - - // Fix IE cloning issues - if ( !support.noCloneChecked && ( elem.nodeType === 1 || elem.nodeType === 11 ) && - !jQuery.isXMLDoc( elem ) ) { - - // We eschew Sizzle here for performance reasons: https://jsperf.com/getall-vs-sizzle/2 - destElements = getAll( clone ); - srcElements = getAll( elem ); - - for ( i = 0, l = srcElements.length; i < l; i++ ) { - fixInput( srcElements[ i ], destElements[ i ] ); - } - } - - // Copy the events from the original to the clone - if ( dataAndEvents ) { - if ( deepDataAndEvents ) { - srcElements = srcElements || getAll( elem ); - destElements = destElements || getAll( clone ); - - for ( i = 0, l = srcElements.length; i < l; i++ ) { - cloneCopyEvent( srcElements[ i ], destElements[ i ] ); - } - } else { - cloneCopyEvent( elem, clone ); - } - } - - // Preserve script evaluation history - destElements = getAll( clone, "script" ); - if ( destElements.length > 0 ) { - setGlobalEval( destElements, !inPage && getAll( elem, "script" ) ); - } - - // Return the cloned set - return clone; - }, - - cleanData: function( elems ) { - var data, elem, type, - special = jQuery.event.special, - i = 0; - - for ( ; ( elem = elems[ i ] ) !== undefined; i++ ) { - if ( acceptData( elem ) ) { - if ( ( data = elem[ dataPriv.expando ] ) ) { - if ( data.events ) { - for ( type in data.events ) { - if ( special[ type ] ) { - jQuery.event.remove( elem, type ); - - // This is a shortcut to avoid jQuery.event.remove's overhead - } else { - jQuery.removeEvent( elem, type, data.handle ); - } - } - } - - // Support: Chrome <=35 - 45+ - // Assign undefined instead of using delete, see Data#remove - elem[ dataPriv.expando ] = undefined; - } - if ( elem[ dataUser.expando ] ) { - - // Support: Chrome <=35 - 45+ - // Assign undefined instead of using delete, see Data#remove - elem[ dataUser.expando ] = undefined; - } - } - } - } -} ); - -jQuery.fn.extend( { - detach: function( selector ) { - return remove( this, selector, true ); - }, - - remove: function( selector ) { - return remove( this, selector ); - }, - - text: function( value ) { - return access( this, function( value ) { - return value === undefined ? - jQuery.text( this ) : - this.empty().each( function() { - if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { - this.textContent = value; - } - } ); - }, null, value, arguments.length ); - }, - - append: function() { - return domManip( this, arguments, function( elem ) { - if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { - var target = manipulationTarget( this, elem ); - target.appendChild( elem ); - } - } ); - }, - - prepend: function() { - return domManip( this, arguments, function( elem ) { - if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { - var target = manipulationTarget( this, elem ); - target.insertBefore( elem, target.firstChild ); - } - } ); - }, - - before: function() { - return domManip( this, arguments, function( elem ) { - if ( this.parentNode ) { - this.parentNode.insertBefore( elem, this ); - } - } ); - }, - - after: function() { - return domManip( this, arguments, function( elem ) { - if ( this.parentNode ) { - this.parentNode.insertBefore( elem, this.nextSibling ); - } - } ); - }, - - empty: function() { - var elem, - i = 0; - - for ( ; ( elem = this[ i ] ) != null; i++ ) { - if ( elem.nodeType === 1 ) { - - // Prevent memory leaks - jQuery.cleanData( getAll( elem, false ) ); - - // Remove any remaining nodes - elem.textContent = ""; - } - } - - return this; - }, - - clone: function( dataAndEvents, deepDataAndEvents ) { - dataAndEvents = dataAndEvents == null ? false : dataAndEvents; - deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents; - - return this.map( function() { - return jQuery.clone( this, dataAndEvents, deepDataAndEvents ); - } ); - }, - - html: function( value ) { - return access( this, function( value ) { - var elem = this[ 0 ] || {}, - i = 0, - l = this.length; - - if ( value === undefined && elem.nodeType === 1 ) { - return elem.innerHTML; - } - - // See if we can take a shortcut and just use innerHTML - if ( typeof value === "string" && !rnoInnerhtml.test( value ) && - !wrapMap[ ( rtagName.exec( value ) || [ "", "" ] )[ 1 ].toLowerCase() ] ) { - - value = jQuery.htmlPrefilter( value ); - - try { - for ( ; i < l; i++ ) { - elem = this[ i ] || {}; - - // Remove element nodes and prevent memory leaks - if ( elem.nodeType === 1 ) { - jQuery.cleanData( getAll( elem, false ) ); - elem.innerHTML = value; - } - } - - elem = 0; - - // If using innerHTML throws an exception, use the fallback method - } catch ( e ) {} - } - - if ( elem ) { - this.empty().append( value ); - } - }, null, value, arguments.length ); - }, - - replaceWith: function() { - var ignored = []; - - // Make the changes, replacing each non-ignored context element with the new content - return domManip( this, arguments, function( elem ) { - var parent = this.parentNode; - - if ( jQuery.inArray( this, ignored ) < 0 ) { - jQuery.cleanData( getAll( this ) ); - if ( parent ) { - parent.replaceChild( elem, this ); - } - } - - // Force callback invocation - }, ignored ); - } -} ); - -jQuery.each( { - appendTo: "append", - prependTo: "prepend", - insertBefore: "before", - insertAfter: "after", - replaceAll: "replaceWith" -}, function( name, original ) { - jQuery.fn[ name ] = function( selector ) { - var elems, - ret = [], - insert = jQuery( selector ), - last = insert.length - 1, - i = 0; - - for ( ; i <= last; i++ ) { - elems = i === last ? this : this.clone( true ); - jQuery( insert[ i ] )[ original ]( elems ); - - // Support: Android <=4.0 only, PhantomJS 1 only - // .get() because push.apply(_, arraylike) throws on ancient WebKit - push.apply( ret, elems.get() ); - } - - return this.pushStack( ret ); - }; -} ); -var rmargin = ( /^margin/ ); - -var rnumnonpx = new RegExp( "^(" + pnum + ")(?!px)[a-z%]+$", "i" ); - -var getStyles = function( elem ) { - - // Support: IE <=11 only, Firefox <=30 (#15098, #14150) - // IE throws on elements created in popups - // FF meanwhile throws on frame elements through "defaultView.getComputedStyle" - var view = elem.ownerDocument.defaultView; - - if ( !view || !view.opener ) { - view = window; - } - - return view.getComputedStyle( elem ); - }; - - - -( function() { - - // Executing both pixelPosition & boxSizingReliable tests require only one layout - // so they're executed at the same time to save the second computation. - function computeStyleTests() { - - // This is a singleton, we need to execute it only once - if ( !div ) { - return; - } - - div.style.cssText = - "box-sizing:border-box;" + - "position:relative;display:block;" + - "margin:auto;border:1px;padding:1px;" + - "top:1%;width:50%"; - div.innerHTML = ""; - documentElement.appendChild( container ); - - var divStyle = window.getComputedStyle( div ); - pixelPositionVal = divStyle.top !== "1%"; - - // Support: Android 4.0 - 4.3 only, Firefox <=3 - 44 - reliableMarginLeftVal = divStyle.marginLeft === "2px"; - boxSizingReliableVal = divStyle.width === "4px"; - - // Support: Android 4.0 - 4.3 only - // Some styles come back with percentage values, even though they shouldn't - div.style.marginRight = "50%"; - pixelMarginRightVal = divStyle.marginRight === "4px"; - - documentElement.removeChild( container ); - - // Nullify the div so it wouldn't be stored in the memory and - // it will also be a sign that checks already performed - div = null; - } - - var pixelPositionVal, boxSizingReliableVal, pixelMarginRightVal, reliableMarginLeftVal, - container = document.createElement( "div" ), - div = document.createElement( "div" ); - - // Finish early in limited (non-browser) environments - if ( !div.style ) { - return; - } - - // Support: IE <=9 - 11 only - // Style of cloned element affects source element cloned (#8908) - div.style.backgroundClip = "content-box"; - div.cloneNode( true ).style.backgroundClip = ""; - support.clearCloneStyle = div.style.backgroundClip === "content-box"; - - container.style.cssText = "border:0;width:8px;height:0;top:0;left:-9999px;" + - "padding:0;margin-top:1px;position:absolute"; - container.appendChild( div ); - - jQuery.extend( support, { - pixelPosition: function() { - computeStyleTests(); - return pixelPositionVal; - }, - boxSizingReliable: function() { - computeStyleTests(); - return boxSizingReliableVal; - }, - pixelMarginRight: function() { - computeStyleTests(); - return pixelMarginRightVal; - }, - reliableMarginLeft: function() { - computeStyleTests(); - return reliableMarginLeftVal; - } - } ); -} )(); - - -function curCSS( elem, name, computed ) { - var width, minWidth, maxWidth, ret, - - // Support: Firefox 51+ - // Retrieving style before computed somehow - // fixes an issue with getting wrong values - // on detached elements - style = elem.style; - - computed = computed || getStyles( elem ); - - // getPropertyValue is needed for: - // .css('filter') (IE 9 only, #12537) - // .css('--customProperty) (#3144) - if ( computed ) { - ret = computed.getPropertyValue( name ) || computed[ name ]; - - if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) { - ret = jQuery.style( elem, name ); - } - - // A tribute to the "awesome hack by Dean Edwards" - // Android Browser returns percentage for some values, - // but width seems to be reliably pixels. - // This is against the CSSOM draft spec: - // https://drafts.csswg.org/cssom/#resolved-values - if ( !support.pixelMarginRight() && rnumnonpx.test( ret ) && rmargin.test( name ) ) { - - // Remember the original values - width = style.width; - minWidth = style.minWidth; - maxWidth = style.maxWidth; - - // Put in the new values to get a computed value out - style.minWidth = style.maxWidth = style.width = ret; - ret = computed.width; - - // Revert the changed values - style.width = width; - style.minWidth = minWidth; - style.maxWidth = maxWidth; - } - } - - return ret !== undefined ? - - // Support: IE <=9 - 11 only - // IE returns zIndex value as an integer. - ret + "" : - ret; -} - - -function addGetHookIf( conditionFn, hookFn ) { - - // Define the hook, we'll check on the first run if it's really needed. - return { - get: function() { - if ( conditionFn() ) { - - // Hook not needed (or it's not possible to use it due - // to missing dependency), remove it. - delete this.get; - return; - } - - // Hook needed; redefine it so that the support test is not executed again. - return ( this.get = hookFn ).apply( this, arguments ); - } - }; -} - - -var - - // Swappable if display is none or starts with table - // except "table", "table-cell", or "table-caption" - // See here for display values: https://developer.mozilla.org/en-US/docs/CSS/display - rdisplayswap = /^(none|table(?!-c[ea]).+)/, - rcustomProp = /^--/, - cssShow = { position: "absolute", visibility: "hidden", display: "block" }, - cssNormalTransform = { - letterSpacing: "0", - fontWeight: "400" - }, - - cssPrefixes = [ "Webkit", "Moz", "ms" ], - emptyStyle = document.createElement( "div" ).style; - -// Return a css property mapped to a potentially vendor prefixed property -function vendorPropName( name ) { - - // Shortcut for names that are not vendor prefixed - if ( name in emptyStyle ) { - return name; - } - - // Check for vendor prefixed names - var capName = name[ 0 ].toUpperCase() + name.slice( 1 ), - i = cssPrefixes.length; - - while ( i-- ) { - name = cssPrefixes[ i ] + capName; - if ( name in emptyStyle ) { - return name; - } - } -} - -// Return a property mapped along what jQuery.cssProps suggests or to -// a vendor prefixed property. -function finalPropName( name ) { - var ret = jQuery.cssProps[ name ]; - if ( !ret ) { - ret = jQuery.cssProps[ name ] = vendorPropName( name ) || name; - } - return ret; -} - -function setPositiveNumber( elem, value, subtract ) { - - // Any relative (+/-) values have already been - // normalized at this point - var matches = rcssNum.exec( value ); - return matches ? - - // Guard against undefined "subtract", e.g., when used as in cssHooks - Math.max( 0, matches[ 2 ] - ( subtract || 0 ) ) + ( matches[ 3 ] || "px" ) : - value; -} - -function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) { - var i, - val = 0; - - // If we already have the right measurement, avoid augmentation - if ( extra === ( isBorderBox ? "border" : "content" ) ) { - i = 4; - - // Otherwise initialize for horizontal or vertical properties - } else { - i = name === "width" ? 1 : 0; - } - - for ( ; i < 4; i += 2 ) { - - // Both box models exclude margin, so add it if we want it - if ( extra === "margin" ) { - val += jQuery.css( elem, extra + cssExpand[ i ], true, styles ); - } - - if ( isBorderBox ) { - - // border-box includes padding, so remove it if we want content - if ( extra === "content" ) { - val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); - } - - // At this point, extra isn't border nor margin, so remove border - if ( extra !== "margin" ) { - val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); - } - } else { - - // At this point, extra isn't content, so add padding - val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); - - // At this point, extra isn't content nor padding, so add border - if ( extra !== "padding" ) { - val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); - } - } - } - - return val; -} - -function getWidthOrHeight( elem, name, extra ) { - - // Start with computed style - var valueIsBorderBox, - styles = getStyles( elem ), - val = curCSS( elem, name, styles ), - isBorderBox = jQuery.css( elem, "boxSizing", false, styles ) === "border-box"; - - // Computed unit is not pixels. Stop here and return. - if ( rnumnonpx.test( val ) ) { - return val; - } - - // Check for style in case a browser which returns unreliable values - // for getComputedStyle silently falls back to the reliable elem.style - valueIsBorderBox = isBorderBox && - ( support.boxSizingReliable() || val === elem.style[ name ] ); - - // Fall back to offsetWidth/Height when value is "auto" - // This happens for inline elements with no explicit setting (gh-3571) - if ( val === "auto" ) { - val = elem[ "offset" + name[ 0 ].toUpperCase() + name.slice( 1 ) ]; - } - - // Normalize "", auto, and prepare for extra - val = parseFloat( val ) || 0; - - // Use the active box-sizing model to add/subtract irrelevant styles - return ( val + - augmentWidthOrHeight( - elem, - name, - extra || ( isBorderBox ? "border" : "content" ), - valueIsBorderBox, - styles - ) - ) + "px"; -} - -jQuery.extend( { - - // Add in style property hooks for overriding the default - // behavior of getting and setting a style property - cssHooks: { - opacity: { - get: function( elem, computed ) { - if ( computed ) { - - // We should always get a number back from opacity - var ret = curCSS( elem, "opacity" ); - return ret === "" ? "1" : ret; - } - } - } - }, - - // Don't automatically add "px" to these possibly-unitless properties - cssNumber: { - "animationIterationCount": true, - "columnCount": true, - "fillOpacity": true, - "flexGrow": true, - "flexShrink": true, - "fontWeight": true, - "lineHeight": true, - "opacity": true, - "order": true, - "orphans": true, - "widows": true, - "zIndex": true, - "zoom": true - }, - - // Add in properties whose names you wish to fix before - // setting or getting the value - cssProps: { - "float": "cssFloat" - }, - - // Get and set the style property on a DOM Node - style: function( elem, name, value, extra ) { - - // Don't set styles on text and comment nodes - if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) { - return; - } - - // Make sure that we're working with the right name - var ret, type, hooks, - origName = jQuery.camelCase( name ), - isCustomProp = rcustomProp.test( name ), - style = elem.style; - - // Make sure that we're working with the right name. We don't - // want to query the value if it is a CSS custom property - // since they are user-defined. - if ( !isCustomProp ) { - name = finalPropName( origName ); - } - - // Gets hook for the prefixed version, then unprefixed version - hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; - - // Check if we're setting a value - if ( value !== undefined ) { - type = typeof value; - - // Convert "+=" or "-=" to relative numbers (#7345) - if ( type === "string" && ( ret = rcssNum.exec( value ) ) && ret[ 1 ] ) { - value = adjustCSS( elem, name, ret ); - - // Fixes bug #9237 - type = "number"; - } - - // Make sure that null and NaN values aren't set (#7116) - if ( value == null || value !== value ) { - return; - } - - // If a number was passed in, add the unit (except for certain CSS properties) - if ( type === "number" ) { - value += ret && ret[ 3 ] || ( jQuery.cssNumber[ origName ] ? "" : "px" ); - } - - // background-* props affect original clone's values - if ( !support.clearCloneStyle && value === "" && name.indexOf( "background" ) === 0 ) { - style[ name ] = "inherit"; - } - - // If a hook was provided, use that value, otherwise just set the specified value - if ( !hooks || !( "set" in hooks ) || - ( value = hooks.set( elem, value, extra ) ) !== undefined ) { - - if ( isCustomProp ) { - style.setProperty( name, value ); - } else { - style[ name ] = value; - } - } - - } else { - - // If a hook was provided get the non-computed value from there - if ( hooks && "get" in hooks && - ( ret = hooks.get( elem, false, extra ) ) !== undefined ) { - - return ret; - } - - // Otherwise just get the value from the style object - return style[ name ]; - } - }, - - css: function( elem, name, extra, styles ) { - var val, num, hooks, - origName = jQuery.camelCase( name ), - isCustomProp = rcustomProp.test( name ); - - // Make sure that we're working with the right name. We don't - // want to modify the value if it is a CSS custom property - // since they are user-defined. - if ( !isCustomProp ) { - name = finalPropName( origName ); - } - - // Try prefixed name followed by the unprefixed name - hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; - - // If a hook was provided get the computed value from there - if ( hooks && "get" in hooks ) { - val = hooks.get( elem, true, extra ); - } - - // Otherwise, if a way to get the computed value exists, use that - if ( val === undefined ) { - val = curCSS( elem, name, styles ); - } - - // Convert "normal" to computed value - if ( val === "normal" && name in cssNormalTransform ) { - val = cssNormalTransform[ name ]; - } - - // Make numeric if forced or a qualifier was provided and val looks numeric - if ( extra === "" || extra ) { - num = parseFloat( val ); - return extra === true || isFinite( num ) ? num || 0 : val; - } - - return val; - } -} ); - -jQuery.each( [ "height", "width" ], function( i, name ) { - jQuery.cssHooks[ name ] = { - get: function( elem, computed, extra ) { - if ( computed ) { - - // Certain elements can have dimension info if we invisibly show them - // but it must have a current display style that would benefit - return rdisplayswap.test( jQuery.css( elem, "display" ) ) && - - // Support: Safari 8+ - // Table columns in Safari have non-zero offsetWidth & zero - // getBoundingClientRect().width unless display is changed. - // Support: IE <=11 only - // Running getBoundingClientRect on a disconnected node - // in IE throws an error. - ( !elem.getClientRects().length || !elem.getBoundingClientRect().width ) ? - swap( elem, cssShow, function() { - return getWidthOrHeight( elem, name, extra ); - } ) : - getWidthOrHeight( elem, name, extra ); - } - }, - - set: function( elem, value, extra ) { - var matches, - styles = extra && getStyles( elem ), - subtract = extra && augmentWidthOrHeight( - elem, - name, - extra, - jQuery.css( elem, "boxSizing", false, styles ) === "border-box", - styles - ); - - // Convert to pixels if value adjustment is needed - if ( subtract && ( matches = rcssNum.exec( value ) ) && - ( matches[ 3 ] || "px" ) !== "px" ) { - - elem.style[ name ] = value; - value = jQuery.css( elem, name ); - } - - return setPositiveNumber( elem, value, subtract ); - } - }; -} ); - -jQuery.cssHooks.marginLeft = addGetHookIf( support.reliableMarginLeft, - function( elem, computed ) { - if ( computed ) { - return ( parseFloat( curCSS( elem, "marginLeft" ) ) || - elem.getBoundingClientRect().left - - swap( elem, { marginLeft: 0 }, function() { - return elem.getBoundingClientRect().left; - } ) - ) + "px"; - } - } -); - -// These hooks are used by animate to expand properties -jQuery.each( { - margin: "", - padding: "", - border: "Width" -}, function( prefix, suffix ) { - jQuery.cssHooks[ prefix + suffix ] = { - expand: function( value ) { - var i = 0, - expanded = {}, - - // Assumes a single number if not a string - parts = typeof value === "string" ? value.split( " " ) : [ value ]; - - for ( ; i < 4; i++ ) { - expanded[ prefix + cssExpand[ i ] + suffix ] = - parts[ i ] || parts[ i - 2 ] || parts[ 0 ]; - } - - return expanded; - } - }; - - if ( !rmargin.test( prefix ) ) { - jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber; - } -} ); - -jQuery.fn.extend( { - css: function( name, value ) { - return access( this, function( elem, name, value ) { - var styles, len, - map = {}, - i = 0; - - if ( Array.isArray( name ) ) { - styles = getStyles( elem ); - len = name.length; - - for ( ; i < len; i++ ) { - map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles ); - } - - return map; - } - - return value !== undefined ? - jQuery.style( elem, name, value ) : - jQuery.css( elem, name ); - }, name, value, arguments.length > 1 ); - } -} ); - - -function Tween( elem, options, prop, end, easing ) { - return new Tween.prototype.init( elem, options, prop, end, easing ); -} -jQuery.Tween = Tween; - -Tween.prototype = { - constructor: Tween, - init: function( elem, options, prop, end, easing, unit ) { - this.elem = elem; - this.prop = prop; - this.easing = easing || jQuery.easing._default; - this.options = options; - this.start = this.now = this.cur(); - this.end = end; - this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" ); - }, - cur: function() { - var hooks = Tween.propHooks[ this.prop ]; - - return hooks && hooks.get ? - hooks.get( this ) : - Tween.propHooks._default.get( this ); - }, - run: function( percent ) { - var eased, - hooks = Tween.propHooks[ this.prop ]; - - if ( this.options.duration ) { - this.pos = eased = jQuery.easing[ this.easing ]( - percent, this.options.duration * percent, 0, 1, this.options.duration - ); - } else { - this.pos = eased = percent; - } - this.now = ( this.end - this.start ) * eased + this.start; - - if ( this.options.step ) { - this.options.step.call( this.elem, this.now, this ); - } - - if ( hooks && hooks.set ) { - hooks.set( this ); - } else { - Tween.propHooks._default.set( this ); - } - return this; - } -}; - -Tween.prototype.init.prototype = Tween.prototype; - -Tween.propHooks = { - _default: { - get: function( tween ) { - var result; - - // Use a property on the element directly when it is not a DOM element, - // or when there is no matching style property that exists. - if ( tween.elem.nodeType !== 1 || - tween.elem[ tween.prop ] != null && tween.elem.style[ tween.prop ] == null ) { - return tween.elem[ tween.prop ]; - } - - // Passing an empty string as a 3rd parameter to .css will automatically - // attempt a parseFloat and fallback to a string if the parse fails. - // Simple values such as "10px" are parsed to Float; - // complex values such as "rotate(1rad)" are returned as-is. - result = jQuery.css( tween.elem, tween.prop, "" ); - - // Empty strings, null, undefined and "auto" are converted to 0. - return !result || result === "auto" ? 0 : result; - }, - set: function( tween ) { - - // Use step hook for back compat. - // Use cssHook if its there. - // Use .style if available and use plain properties where available. - if ( jQuery.fx.step[ tween.prop ] ) { - jQuery.fx.step[ tween.prop ]( tween ); - } else if ( tween.elem.nodeType === 1 && - ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || - jQuery.cssHooks[ tween.prop ] ) ) { - jQuery.style( tween.elem, tween.prop, tween.now + tween.unit ); - } else { - tween.elem[ tween.prop ] = tween.now; - } - } - } -}; - -// Support: IE <=9 only -// Panic based approach to setting things on disconnected nodes -Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = { - set: function( tween ) { - if ( tween.elem.nodeType && tween.elem.parentNode ) { - tween.elem[ tween.prop ] = tween.now; - } - } -}; - -jQuery.easing = { - linear: function( p ) { - return p; - }, - swing: function( p ) { - return 0.5 - Math.cos( p * Math.PI ) / 2; - }, - _default: "swing" -}; - -jQuery.fx = Tween.prototype.init; - -// Back compat <1.8 extension point -jQuery.fx.step = {}; - - - - -var - fxNow, inProgress, - rfxtypes = /^(?:toggle|show|hide)$/, - rrun = /queueHooks$/; - -function schedule() { - if ( inProgress ) { - if ( document.hidden === false && window.requestAnimationFrame ) { - window.requestAnimationFrame( schedule ); - } else { - window.setTimeout( schedule, jQuery.fx.interval ); - } - - jQuery.fx.tick(); - } -} - -// Animations created synchronously will run synchronously -function createFxNow() { - window.setTimeout( function() { - fxNow = undefined; - } ); - return ( fxNow = jQuery.now() ); -} - -// Generate parameters to create a standard animation -function genFx( type, includeWidth ) { - var which, - i = 0, - attrs = { height: type }; - - // If we include width, step value is 1 to do all cssExpand values, - // otherwise step value is 2 to skip over Left and Right - includeWidth = includeWidth ? 1 : 0; - for ( ; i < 4; i += 2 - includeWidth ) { - which = cssExpand[ i ]; - attrs[ "margin" + which ] = attrs[ "padding" + which ] = type; - } - - if ( includeWidth ) { - attrs.opacity = attrs.width = type; - } - - return attrs; -} - -function createTween( value, prop, animation ) { - var tween, - collection = ( Animation.tweeners[ prop ] || [] ).concat( Animation.tweeners[ "*" ] ), - index = 0, - length = collection.length; - for ( ; index < length; index++ ) { - if ( ( tween = collection[ index ].call( animation, prop, value ) ) ) { - - // We're done with this property - return tween; - } - } -} - -function defaultPrefilter( elem, props, opts ) { - var prop, value, toggle, hooks, oldfire, propTween, restoreDisplay, display, - isBox = "width" in props || "height" in props, - anim = this, - orig = {}, - style = elem.style, - hidden = elem.nodeType && isHiddenWithinTree( elem ), - dataShow = dataPriv.get( elem, "fxshow" ); - - // Queue-skipping animations hijack the fx hooks - if ( !opts.queue ) { - hooks = jQuery._queueHooks( elem, "fx" ); - if ( hooks.unqueued == null ) { - hooks.unqueued = 0; - oldfire = hooks.empty.fire; - hooks.empty.fire = function() { - if ( !hooks.unqueued ) { - oldfire(); - } - }; - } - hooks.unqueued++; - - anim.always( function() { - - // Ensure the complete handler is called before this completes - anim.always( function() { - hooks.unqueued--; - if ( !jQuery.queue( elem, "fx" ).length ) { - hooks.empty.fire(); - } - } ); - } ); - } - - // Detect show/hide animations - for ( prop in props ) { - value = props[ prop ]; - if ( rfxtypes.test( value ) ) { - delete props[ prop ]; - toggle = toggle || value === "toggle"; - if ( value === ( hidden ? "hide" : "show" ) ) { - - // Pretend to be hidden if this is a "show" and - // there is still data from a stopped show/hide - if ( value === "show" && dataShow && dataShow[ prop ] !== undefined ) { - hidden = true; - - // Ignore all other no-op show/hide data - } else { - continue; - } - } - orig[ prop ] = dataShow && dataShow[ prop ] || jQuery.style( elem, prop ); - } - } - - // Bail out if this is a no-op like .hide().hide() - propTween = !jQuery.isEmptyObject( props ); - if ( !propTween && jQuery.isEmptyObject( orig ) ) { - return; - } - - // Restrict "overflow" and "display" styles during box animations - if ( isBox && elem.nodeType === 1 ) { - - // Support: IE <=9 - 11, Edge 12 - 13 - // Record all 3 overflow attributes because IE does not infer the shorthand - // from identically-valued overflowX and overflowY - opts.overflow = [ style.overflow, style.overflowX, style.overflowY ]; - - // Identify a display type, preferring old show/hide data over the CSS cascade - restoreDisplay = dataShow && dataShow.display; - if ( restoreDisplay == null ) { - restoreDisplay = dataPriv.get( elem, "display" ); - } - display = jQuery.css( elem, "display" ); - if ( display === "none" ) { - if ( restoreDisplay ) { - display = restoreDisplay; - } else { - - // Get nonempty value(s) by temporarily forcing visibility - showHide( [ elem ], true ); - restoreDisplay = elem.style.display || restoreDisplay; - display = jQuery.css( elem, "display" ); - showHide( [ elem ] ); - } - } - - // Animate inline elements as inline-block - if ( display === "inline" || display === "inline-block" && restoreDisplay != null ) { - if ( jQuery.css( elem, "float" ) === "none" ) { - - // Restore the original display value at the end of pure show/hide animations - if ( !propTween ) { - anim.done( function() { - style.display = restoreDisplay; - } ); - if ( restoreDisplay == null ) { - display = style.display; - restoreDisplay = display === "none" ? "" : display; - } - } - style.display = "inline-block"; - } - } - } - - if ( opts.overflow ) { - style.overflow = "hidden"; - anim.always( function() { - style.overflow = opts.overflow[ 0 ]; - style.overflowX = opts.overflow[ 1 ]; - style.overflowY = opts.overflow[ 2 ]; - } ); - } - - // Implement show/hide animations - propTween = false; - for ( prop in orig ) { - - // General show/hide setup for this element animation - if ( !propTween ) { - if ( dataShow ) { - if ( "hidden" in dataShow ) { - hidden = dataShow.hidden; - } - } else { - dataShow = dataPriv.access( elem, "fxshow", { display: restoreDisplay } ); - } - - // Store hidden/visible for toggle so `.stop().toggle()` "reverses" - if ( toggle ) { - dataShow.hidden = !hidden; - } - - // Show elements before animating them - if ( hidden ) { - showHide( [ elem ], true ); - } - - /* eslint-disable no-loop-func */ - - anim.done( function() { - - /* eslint-enable no-loop-func */ - - // The final step of a "hide" animation is actually hiding the element - if ( !hidden ) { - showHide( [ elem ] ); - } - dataPriv.remove( elem, "fxshow" ); - for ( prop in orig ) { - jQuery.style( elem, prop, orig[ prop ] ); - } - } ); - } - - // Per-property setup - propTween = createTween( hidden ? dataShow[ prop ] : 0, prop, anim ); - if ( !( prop in dataShow ) ) { - dataShow[ prop ] = propTween.start; - if ( hidden ) { - propTween.end = propTween.start; - propTween.start = 0; - } - } - } -} - -function propFilter( props, specialEasing ) { - var index, name, easing, value, hooks; - - // camelCase, specialEasing and expand cssHook pass - for ( index in props ) { - name = jQuery.camelCase( index ); - easing = specialEasing[ name ]; - value = props[ index ]; - if ( Array.isArray( value ) ) { - easing = value[ 1 ]; - value = props[ index ] = value[ 0 ]; - } - - if ( index !== name ) { - props[ name ] = value; - delete props[ index ]; - } - - hooks = jQuery.cssHooks[ name ]; - if ( hooks && "expand" in hooks ) { - value = hooks.expand( value ); - delete props[ name ]; - - // Not quite $.extend, this won't overwrite existing keys. - // Reusing 'index' because we have the correct "name" - for ( index in value ) { - if ( !( index in props ) ) { - props[ index ] = value[ index ]; - specialEasing[ index ] = easing; - } - } - } else { - specialEasing[ name ] = easing; - } - } -} - -function Animation( elem, properties, options ) { - var result, - stopped, - index = 0, - length = Animation.prefilters.length, - deferred = jQuery.Deferred().always( function() { - - // Don't match elem in the :animated selector - delete tick.elem; - } ), - tick = function() { - if ( stopped ) { - return false; - } - var currentTime = fxNow || createFxNow(), - remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ), - - // Support: Android 2.3 only - // Archaic crash bug won't allow us to use `1 - ( 0.5 || 0 )` (#12497) - temp = remaining / animation.duration || 0, - percent = 1 - temp, - index = 0, - length = animation.tweens.length; - - for ( ; index < length; index++ ) { - animation.tweens[ index ].run( percent ); - } - - deferred.notifyWith( elem, [ animation, percent, remaining ] ); - - // If there's more to do, yield - if ( percent < 1 && length ) { - return remaining; - } - - // If this was an empty animation, synthesize a final progress notification - if ( !length ) { - deferred.notifyWith( elem, [ animation, 1, 0 ] ); - } - - // Resolve the animation and report its conclusion - deferred.resolveWith( elem, [ animation ] ); - return false; - }, - animation = deferred.promise( { - elem: elem, - props: jQuery.extend( {}, properties ), - opts: jQuery.extend( true, { - specialEasing: {}, - easing: jQuery.easing._default - }, options ), - originalProperties: properties, - originalOptions: options, - startTime: fxNow || createFxNow(), - duration: options.duration, - tweens: [], - createTween: function( prop, end ) { - var tween = jQuery.Tween( elem, animation.opts, prop, end, - animation.opts.specialEasing[ prop ] || animation.opts.easing ); - animation.tweens.push( tween ); - return tween; - }, - stop: function( gotoEnd ) { - var index = 0, - - // If we are going to the end, we want to run all the tweens - // otherwise we skip this part - length = gotoEnd ? animation.tweens.length : 0; - if ( stopped ) { - return this; - } - stopped = true; - for ( ; index < length; index++ ) { - animation.tweens[ index ].run( 1 ); - } - - // Resolve when we played the last frame; otherwise, reject - if ( gotoEnd ) { - deferred.notifyWith( elem, [ animation, 1, 0 ] ); - deferred.resolveWith( elem, [ animation, gotoEnd ] ); - } else { - deferred.rejectWith( elem, [ animation, gotoEnd ] ); - } - return this; - } - } ), - props = animation.props; - - propFilter( props, animation.opts.specialEasing ); - - for ( ; index < length; index++ ) { - result = Animation.prefilters[ index ].call( animation, elem, props, animation.opts ); - if ( result ) { - if ( jQuery.isFunction( result.stop ) ) { - jQuery._queueHooks( animation.elem, animation.opts.queue ).stop = - jQuery.proxy( result.stop, result ); - } - return result; - } - } - - jQuery.map( props, createTween, animation ); - - if ( jQuery.isFunction( animation.opts.start ) ) { - animation.opts.start.call( elem, animation ); - } - - // Attach callbacks from options - animation - .progress( animation.opts.progress ) - .done( animation.opts.done, animation.opts.complete ) - .fail( animation.opts.fail ) - .always( animation.opts.always ); - - jQuery.fx.timer( - jQuery.extend( tick, { - elem: elem, - anim: animation, - queue: animation.opts.queue - } ) - ); - - return animation; -} - -jQuery.Animation = jQuery.extend( Animation, { - - tweeners: { - "*": [ function( prop, value ) { - var tween = this.createTween( prop, value ); - adjustCSS( tween.elem, prop, rcssNum.exec( value ), tween ); - return tween; - } ] - }, - - tweener: function( props, callback ) { - if ( jQuery.isFunction( props ) ) { - callback = props; - props = [ "*" ]; - } else { - props = props.match( rnothtmlwhite ); - } - - var prop, - index = 0, - length = props.length; - - for ( ; index < length; index++ ) { - prop = props[ index ]; - Animation.tweeners[ prop ] = Animation.tweeners[ prop ] || []; - Animation.tweeners[ prop ].unshift( callback ); - } - }, - - prefilters: [ defaultPrefilter ], - - prefilter: function( callback, prepend ) { - if ( prepend ) { - Animation.prefilters.unshift( callback ); - } else { - Animation.prefilters.push( callback ); - } - } -} ); - -jQuery.speed = function( speed, easing, fn ) { - var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : { - complete: fn || !fn && easing || - jQuery.isFunction( speed ) && speed, - duration: speed, - easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing - }; - - // Go to the end state if fx are off - if ( jQuery.fx.off ) { - opt.duration = 0; - - } else { - if ( typeof opt.duration !== "number" ) { - if ( opt.duration in jQuery.fx.speeds ) { - opt.duration = jQuery.fx.speeds[ opt.duration ]; - - } else { - opt.duration = jQuery.fx.speeds._default; - } - } - } - - // Normalize opt.queue - true/undefined/null -> "fx" - if ( opt.queue == null || opt.queue === true ) { - opt.queue = "fx"; - } - - // Queueing - opt.old = opt.complete; - - opt.complete = function() { - if ( jQuery.isFunction( opt.old ) ) { - opt.old.call( this ); - } - - if ( opt.queue ) { - jQuery.dequeue( this, opt.queue ); - } - }; - - return opt; -}; - -jQuery.fn.extend( { - fadeTo: function( speed, to, easing, callback ) { - - // Show any hidden elements after setting opacity to 0 - return this.filter( isHiddenWithinTree ).css( "opacity", 0 ).show() - - // Animate to the value specified - .end().animate( { opacity: to }, speed, easing, callback ); - }, - animate: function( prop, speed, easing, callback ) { - var empty = jQuery.isEmptyObject( prop ), - optall = jQuery.speed( speed, easing, callback ), - doAnimation = function() { - - // Operate on a copy of prop so per-property easing won't be lost - var anim = Animation( this, jQuery.extend( {}, prop ), optall ); - - // Empty animations, or finishing resolves immediately - if ( empty || dataPriv.get( this, "finish" ) ) { - anim.stop( true ); - } - }; - doAnimation.finish = doAnimation; - - return empty || optall.queue === false ? - this.each( doAnimation ) : - this.queue( optall.queue, doAnimation ); - }, - stop: function( type, clearQueue, gotoEnd ) { - var stopQueue = function( hooks ) { - var stop = hooks.stop; - delete hooks.stop; - stop( gotoEnd ); - }; - - if ( typeof type !== "string" ) { - gotoEnd = clearQueue; - clearQueue = type; - type = undefined; - } - if ( clearQueue && type !== false ) { - this.queue( type || "fx", [] ); - } - - return this.each( function() { - var dequeue = true, - index = type != null && type + "queueHooks", - timers = jQuery.timers, - data = dataPriv.get( this ); - - if ( index ) { - if ( data[ index ] && data[ index ].stop ) { - stopQueue( data[ index ] ); - } - } else { - for ( index in data ) { - if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) { - stopQueue( data[ index ] ); - } - } - } - - for ( index = timers.length; index--; ) { - if ( timers[ index ].elem === this && - ( type == null || timers[ index ].queue === type ) ) { - - timers[ index ].anim.stop( gotoEnd ); - dequeue = false; - timers.splice( index, 1 ); - } - } - - // Start the next in the queue if the last step wasn't forced. - // Timers currently will call their complete callbacks, which - // will dequeue but only if they were gotoEnd. - if ( dequeue || !gotoEnd ) { - jQuery.dequeue( this, type ); - } - } ); - }, - finish: function( type ) { - if ( type !== false ) { - type = type || "fx"; - } - return this.each( function() { - var index, - data = dataPriv.get( this ), - queue = data[ type + "queue" ], - hooks = data[ type + "queueHooks" ], - timers = jQuery.timers, - length = queue ? queue.length : 0; - - // Enable finishing flag on private data - data.finish = true; - - // Empty the queue first - jQuery.queue( this, type, [] ); - - if ( hooks && hooks.stop ) { - hooks.stop.call( this, true ); - } - - // Look for any active animations, and finish them - for ( index = timers.length; index--; ) { - if ( timers[ index ].elem === this && timers[ index ].queue === type ) { - timers[ index ].anim.stop( true ); - timers.splice( index, 1 ); - } - } - - // Look for any animations in the old queue and finish them - for ( index = 0; index < length; index++ ) { - if ( queue[ index ] && queue[ index ].finish ) { - queue[ index ].finish.call( this ); - } - } - - // Turn off finishing flag - delete data.finish; - } ); - } -} ); - -jQuery.each( [ "toggle", "show", "hide" ], function( i, name ) { - var cssFn = jQuery.fn[ name ]; - jQuery.fn[ name ] = function( speed, easing, callback ) { - return speed == null || typeof speed === "boolean" ? - cssFn.apply( this, arguments ) : - this.animate( genFx( name, true ), speed, easing, callback ); - }; -} ); - -// Generate shortcuts for custom animations -jQuery.each( { - slideDown: genFx( "show" ), - slideUp: genFx( "hide" ), - slideToggle: genFx( "toggle" ), - fadeIn: { opacity: "show" }, - fadeOut: { opacity: "hide" }, - fadeToggle: { opacity: "toggle" } -}, function( name, props ) { - jQuery.fn[ name ] = function( speed, easing, callback ) { - return this.animate( props, speed, easing, callback ); - }; -} ); - -jQuery.timers = []; -jQuery.fx.tick = function() { - var timer, - i = 0, - timers = jQuery.timers; - - fxNow = jQuery.now(); - - for ( ; i < timers.length; i++ ) { - timer = timers[ i ]; - - // Run the timer and safely remove it when done (allowing for external removal) - if ( !timer() && timers[ i ] === timer ) { - timers.splice( i--, 1 ); - } - } - - if ( !timers.length ) { - jQuery.fx.stop(); - } - fxNow = undefined; -}; - -jQuery.fx.timer = function( timer ) { - jQuery.timers.push( timer ); - jQuery.fx.start(); -}; - -jQuery.fx.interval = 13; -jQuery.fx.start = function() { - if ( inProgress ) { - return; - } - - inProgress = true; - schedule(); -}; - -jQuery.fx.stop = function() { - inProgress = null; -}; - -jQuery.fx.speeds = { - slow: 600, - fast: 200, - - // Default speed - _default: 400 -}; - - -// Based off of the plugin by Clint Helfers, with permission. -// https://web.archive.org/web/20100324014747/http://blindsignals.com/index.php/2009/07/jquery-delay/ -jQuery.fn.delay = function( time, type ) { - time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time; - type = type || "fx"; - - return this.queue( type, function( next, hooks ) { - var timeout = window.setTimeout( next, time ); - hooks.stop = function() { - window.clearTimeout( timeout ); - }; - } ); -}; - - -( function() { - var input = document.createElement( "input" ), - select = document.createElement( "select" ), - opt = select.appendChild( document.createElement( "option" ) ); - - input.type = "checkbox"; - - // Support: Android <=4.3 only - // Default value for a checkbox should be "on" - support.checkOn = input.value !== ""; - - // Support: IE <=11 only - // Must access selectedIndex to make default options select - support.optSelected = opt.selected; - - // Support: IE <=11 only - // An input loses its value after becoming a radio - input = document.createElement( "input" ); - input.value = "t"; - input.type = "radio"; - support.radioValue = input.value === "t"; -} )(); - - -var boolHook, - attrHandle = jQuery.expr.attrHandle; - -jQuery.fn.extend( { - attr: function( name, value ) { - return access( this, jQuery.attr, name, value, arguments.length > 1 ); - }, - - removeAttr: function( name ) { - return this.each( function() { - jQuery.removeAttr( this, name ); - } ); - } -} ); - -jQuery.extend( { - attr: function( elem, name, value ) { - var ret, hooks, - nType = elem.nodeType; - - // Don't get/set attributes on text, comment and attribute nodes - if ( nType === 3 || nType === 8 || nType === 2 ) { - return; - } - - // Fallback to prop when attributes are not supported - if ( typeof elem.getAttribute === "undefined" ) { - return jQuery.prop( elem, name, value ); - } - - // Attribute hooks are determined by the lowercase version - // Grab necessary hook if one is defined - if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { - hooks = jQuery.attrHooks[ name.toLowerCase() ] || - ( jQuery.expr.match.bool.test( name ) ? boolHook : undefined ); - } - - if ( value !== undefined ) { - if ( value === null ) { - jQuery.removeAttr( elem, name ); - return; - } - - if ( hooks && "set" in hooks && - ( ret = hooks.set( elem, value, name ) ) !== undefined ) { - return ret; - } - - elem.setAttribute( name, value + "" ); - return value; - } - - if ( hooks && "get" in hooks && ( ret = hooks.get( elem, name ) ) !== null ) { - return ret; - } - - ret = jQuery.find.attr( elem, name ); - - // Non-existent attributes return null, we normalize to undefined - return ret == null ? undefined : ret; - }, - - attrHooks: { - type: { - set: function( elem, value ) { - if ( !support.radioValue && value === "radio" && - nodeName( elem, "input" ) ) { - var val = elem.value; - elem.setAttribute( "type", value ); - if ( val ) { - elem.value = val; - } - return value; - } - } - } - }, - - removeAttr: function( elem, value ) { - var name, - i = 0, - - // Attribute names can contain non-HTML whitespace characters - // https://html.spec.whatwg.org/multipage/syntax.html#attributes-2 - attrNames = value && value.match( rnothtmlwhite ); - - if ( attrNames && elem.nodeType === 1 ) { - while ( ( name = attrNames[ i++ ] ) ) { - elem.removeAttribute( name ); - } - } - } -} ); - -// Hooks for boolean attributes -boolHook = { - set: function( elem, value, name ) { - if ( value === false ) { - - // Remove boolean attributes when set to false - jQuery.removeAttr( elem, name ); - } else { - elem.setAttribute( name, name ); - } - return name; - } -}; - -jQuery.each( jQuery.expr.match.bool.source.match( /\w+/g ), function( i, name ) { - var getter = attrHandle[ name ] || jQuery.find.attr; - - attrHandle[ name ] = function( elem, name, isXML ) { - var ret, handle, - lowercaseName = name.toLowerCase(); - - if ( !isXML ) { - - // Avoid an infinite loop by temporarily removing this function from the getter - handle = attrHandle[ lowercaseName ]; - attrHandle[ lowercaseName ] = ret; - ret = getter( elem, name, isXML ) != null ? - lowercaseName : - null; - attrHandle[ lowercaseName ] = handle; - } - return ret; - }; -} ); - - - - -var rfocusable = /^(?:input|select|textarea|button)$/i, - rclickable = /^(?:a|area)$/i; - -jQuery.fn.extend( { - prop: function( name, value ) { - return access( this, jQuery.prop, name, value, arguments.length > 1 ); - }, - - removeProp: function( name ) { - return this.each( function() { - delete this[ jQuery.propFix[ name ] || name ]; - } ); - } -} ); - -jQuery.extend( { - prop: function( elem, name, value ) { - var ret, hooks, - nType = elem.nodeType; - - // Don't get/set properties on text, comment and attribute nodes - if ( nType === 3 || nType === 8 || nType === 2 ) { - return; - } - - if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { - - // Fix name and attach hooks - name = jQuery.propFix[ name ] || name; - hooks = jQuery.propHooks[ name ]; - } - - if ( value !== undefined ) { - if ( hooks && "set" in hooks && - ( ret = hooks.set( elem, value, name ) ) !== undefined ) { - return ret; - } - - return ( elem[ name ] = value ); - } - - if ( hooks && "get" in hooks && ( ret = hooks.get( elem, name ) ) !== null ) { - return ret; - } - - return elem[ name ]; - }, - - propHooks: { - tabIndex: { - get: function( elem ) { - - // Support: IE <=9 - 11 only - // elem.tabIndex doesn't always return the - // correct value when it hasn't been explicitly set - // https://web.archive.org/web/20141116233347/http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/ - // Use proper attribute retrieval(#12072) - var tabindex = jQuery.find.attr( elem, "tabindex" ); - - if ( tabindex ) { - return parseInt( tabindex, 10 ); - } - - if ( - rfocusable.test( elem.nodeName ) || - rclickable.test( elem.nodeName ) && - elem.href - ) { - return 0; - } - - return -1; - } - } - }, - - propFix: { - "for": "htmlFor", - "class": "className" - } -} ); - -// Support: IE <=11 only -// Accessing the selectedIndex property -// forces the browser to respect setting selected -// on the option -// The getter ensures a default option is selected -// when in an optgroup -// eslint rule "no-unused-expressions" is disabled for this code -// since it considers such accessions noop -if ( !support.optSelected ) { - jQuery.propHooks.selected = { - get: function( elem ) { - - /* eslint no-unused-expressions: "off" */ - - var parent = elem.parentNode; - if ( parent && parent.parentNode ) { - parent.parentNode.selectedIndex; - } - return null; - }, - set: function( elem ) { - - /* eslint no-unused-expressions: "off" */ - - var parent = elem.parentNode; - if ( parent ) { - parent.selectedIndex; - - if ( parent.parentNode ) { - parent.parentNode.selectedIndex; - } - } - } - }; -} - -jQuery.each( [ - "tabIndex", - "readOnly", - "maxLength", - "cellSpacing", - "cellPadding", - "rowSpan", - "colSpan", - "useMap", - "frameBorder", - "contentEditable" -], function() { - jQuery.propFix[ this.toLowerCase() ] = this; -} ); - - - - - // Strip and collapse whitespace according to HTML spec - // https://html.spec.whatwg.org/multipage/infrastructure.html#strip-and-collapse-whitespace - function stripAndCollapse( value ) { - var tokens = value.match( rnothtmlwhite ) || []; - return tokens.join( " " ); - } - - -function getClass( elem ) { - return elem.getAttribute && elem.getAttribute( "class" ) || ""; -} - -jQuery.fn.extend( { - addClass: function( value ) { - var classes, elem, cur, curValue, clazz, j, finalValue, - i = 0; - - if ( jQuery.isFunction( value ) ) { - return this.each( function( j ) { - jQuery( this ).addClass( value.call( this, j, getClass( this ) ) ); - } ); - } - - if ( typeof value === "string" && value ) { - classes = value.match( rnothtmlwhite ) || []; - - while ( ( elem = this[ i++ ] ) ) { - curValue = getClass( elem ); - cur = elem.nodeType === 1 && ( " " + stripAndCollapse( curValue ) + " " ); - - if ( cur ) { - j = 0; - while ( ( clazz = classes[ j++ ] ) ) { - if ( cur.indexOf( " " + clazz + " " ) < 0 ) { - cur += clazz + " "; - } - } - - // Only assign if different to avoid unneeded rendering. - finalValue = stripAndCollapse( cur ); - if ( curValue !== finalValue ) { - elem.setAttribute( "class", finalValue ); - } - } - } - } - - return this; - }, - - removeClass: function( value ) { - var classes, elem, cur, curValue, clazz, j, finalValue, - i = 0; - - if ( jQuery.isFunction( value ) ) { - return this.each( function( j ) { - jQuery( this ).removeClass( value.call( this, j, getClass( this ) ) ); - } ); - } - - if ( !arguments.length ) { - return this.attr( "class", "" ); - } - - if ( typeof value === "string" && value ) { - classes = value.match( rnothtmlwhite ) || []; - - while ( ( elem = this[ i++ ] ) ) { - curValue = getClass( elem ); - - // This expression is here for better compressibility (see addClass) - cur = elem.nodeType === 1 && ( " " + stripAndCollapse( curValue ) + " " ); - - if ( cur ) { - j = 0; - while ( ( clazz = classes[ j++ ] ) ) { - - // Remove *all* instances - while ( cur.indexOf( " " + clazz + " " ) > -1 ) { - cur = cur.replace( " " + clazz + " ", " " ); - } - } - - // Only assign if different to avoid unneeded rendering. - finalValue = stripAndCollapse( cur ); - if ( curValue !== finalValue ) { - elem.setAttribute( "class", finalValue ); - } - } - } - } - - return this; - }, - - toggleClass: function( value, stateVal ) { - var type = typeof value; - - if ( typeof stateVal === "boolean" && type === "string" ) { - return stateVal ? this.addClass( value ) : this.removeClass( value ); - } - - if ( jQuery.isFunction( value ) ) { - return this.each( function( i ) { - jQuery( this ).toggleClass( - value.call( this, i, getClass( this ), stateVal ), - stateVal - ); - } ); - } - - return this.each( function() { - var className, i, self, classNames; - - if ( type === "string" ) { - - // Toggle individual class names - i = 0; - self = jQuery( this ); - classNames = value.match( rnothtmlwhite ) || []; - - while ( ( className = classNames[ i++ ] ) ) { - - // Check each className given, space separated list - if ( self.hasClass( className ) ) { - self.removeClass( className ); - } else { - self.addClass( className ); - } - } - - // Toggle whole class name - } else if ( value === undefined || type === "boolean" ) { - className = getClass( this ); - if ( className ) { - - // Store className if set - dataPriv.set( this, "__className__", className ); - } - - // If the element has a class name or if we're passed `false`, - // then remove the whole classname (if there was one, the above saved it). - // Otherwise bring back whatever was previously saved (if anything), - // falling back to the empty string if nothing was stored. - if ( this.setAttribute ) { - this.setAttribute( "class", - className || value === false ? - "" : - dataPriv.get( this, "__className__" ) || "" - ); - } - } - } ); - }, - - hasClass: function( selector ) { - var className, elem, - i = 0; - - className = " " + selector + " "; - while ( ( elem = this[ i++ ] ) ) { - if ( elem.nodeType === 1 && - ( " " + stripAndCollapse( getClass( elem ) ) + " " ).indexOf( className ) > -1 ) { - return true; - } - } - - return false; - } -} ); - - - - -var rreturn = /\r/g; - -jQuery.fn.extend( { - val: function( value ) { - var hooks, ret, isFunction, - elem = this[ 0 ]; - - if ( !arguments.length ) { - if ( elem ) { - hooks = jQuery.valHooks[ elem.type ] || - jQuery.valHooks[ elem.nodeName.toLowerCase() ]; - - if ( hooks && - "get" in hooks && - ( ret = hooks.get( elem, "value" ) ) !== undefined - ) { - return ret; - } - - ret = elem.value; - - // Handle most common string cases - if ( typeof ret === "string" ) { - return ret.replace( rreturn, "" ); - } - - // Handle cases where value is null/undef or number - return ret == null ? "" : ret; - } - - return; - } - - isFunction = jQuery.isFunction( value ); - - return this.each( function( i ) { - var val; - - if ( this.nodeType !== 1 ) { - return; - } - - if ( isFunction ) { - val = value.call( this, i, jQuery( this ).val() ); - } else { - val = value; - } - - // Treat null/undefined as ""; convert numbers to string - if ( val == null ) { - val = ""; - - } else if ( typeof val === "number" ) { - val += ""; - - } else if ( Array.isArray( val ) ) { - val = jQuery.map( val, function( value ) { - return value == null ? "" : value + ""; - } ); - } - - hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ]; - - // If set returns undefined, fall back to normal setting - if ( !hooks || !( "set" in hooks ) || hooks.set( this, val, "value" ) === undefined ) { - this.value = val; - } - } ); - } -} ); - -jQuery.extend( { - valHooks: { - option: { - get: function( elem ) { - - var val = jQuery.find.attr( elem, "value" ); - return val != null ? - val : - - // Support: IE <=10 - 11 only - // option.text throws exceptions (#14686, #14858) - // Strip and collapse whitespace - // https://html.spec.whatwg.org/#strip-and-collapse-whitespace - stripAndCollapse( jQuery.text( elem ) ); - } - }, - select: { - get: function( elem ) { - var value, option, i, - options = elem.options, - index = elem.selectedIndex, - one = elem.type === "select-one", - values = one ? null : [], - max = one ? index + 1 : options.length; - - if ( index < 0 ) { - i = max; - - } else { - i = one ? index : 0; - } - - // Loop through all the selected options - for ( ; i < max; i++ ) { - option = options[ i ]; - - // Support: IE <=9 only - // IE8-9 doesn't update selected after form reset (#2551) - if ( ( option.selected || i === index ) && - - // Don't return options that are disabled or in a disabled optgroup - !option.disabled && - ( !option.parentNode.disabled || - !nodeName( option.parentNode, "optgroup" ) ) ) { - - // Get the specific value for the option - value = jQuery( option ).val(); - - // We don't need an array for one selects - if ( one ) { - return value; - } - - // Multi-Selects return an array - values.push( value ); - } - } - - return values; - }, - - set: function( elem, value ) { - var optionSet, option, - options = elem.options, - values = jQuery.makeArray( value ), - i = options.length; - - while ( i-- ) { - option = options[ i ]; - - /* eslint-disable no-cond-assign */ - - if ( option.selected = - jQuery.inArray( jQuery.valHooks.option.get( option ), values ) > -1 - ) { - optionSet = true; - } - - /* eslint-enable no-cond-assign */ - } - - // Force browsers to behave consistently when non-matching value is set - if ( !optionSet ) { - elem.selectedIndex = -1; - } - return values; - } - } - } -} ); - -// Radios and checkboxes getter/setter -jQuery.each( [ "radio", "checkbox" ], function() { - jQuery.valHooks[ this ] = { - set: function( elem, value ) { - if ( Array.isArray( value ) ) { - return ( elem.checked = jQuery.inArray( jQuery( elem ).val(), value ) > -1 ); - } - } - }; - if ( !support.checkOn ) { - jQuery.valHooks[ this ].get = function( elem ) { - return elem.getAttribute( "value" ) === null ? "on" : elem.value; - }; - } -} ); - - - - -// Return jQuery for attributes-only inclusion - - -var rfocusMorph = /^(?:focusinfocus|focusoutblur)$/; - -jQuery.extend( jQuery.event, { - - trigger: function( event, data, elem, onlyHandlers ) { - - var i, cur, tmp, bubbleType, ontype, handle, special, - eventPath = [ elem || document ], - type = hasOwn.call( event, "type" ) ? event.type : event, - namespaces = hasOwn.call( event, "namespace" ) ? event.namespace.split( "." ) : []; - - cur = tmp = elem = elem || document; - - // Don't do events on text and comment nodes - if ( elem.nodeType === 3 || elem.nodeType === 8 ) { - return; - } - - // focus/blur morphs to focusin/out; ensure we're not firing them right now - if ( rfocusMorph.test( type + jQuery.event.triggered ) ) { - return; - } - - if ( type.indexOf( "." ) > -1 ) { - - // Namespaced trigger; create a regexp to match event type in handle() - namespaces = type.split( "." ); - type = namespaces.shift(); - namespaces.sort(); - } - ontype = type.indexOf( ":" ) < 0 && "on" + type; - - // Caller can pass in a jQuery.Event object, Object, or just an event type string - event = event[ jQuery.expando ] ? - event : - new jQuery.Event( type, typeof event === "object" && event ); - - // Trigger bitmask: & 1 for native handlers; & 2 for jQuery (always true) - event.isTrigger = onlyHandlers ? 2 : 3; - event.namespace = namespaces.join( "." ); - event.rnamespace = event.namespace ? - new RegExp( "(^|\\.)" + namespaces.join( "\\.(?:.*\\.|)" ) + "(\\.|$)" ) : - null; - - // Clean up the event in case it is being reused - event.result = undefined; - if ( !event.target ) { - event.target = elem; - } - - // Clone any incoming data and prepend the event, creating the handler arg list - data = data == null ? - [ event ] : - jQuery.makeArray( data, [ event ] ); - - // Allow special events to draw outside the lines - special = jQuery.event.special[ type ] || {}; - if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) { - return; - } - - // Determine event propagation path in advance, per W3C events spec (#9951) - // Bubble up to document, then to window; watch for a global ownerDocument var (#9724) - if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) { - - bubbleType = special.delegateType || type; - if ( !rfocusMorph.test( bubbleType + type ) ) { - cur = cur.parentNode; - } - for ( ; cur; cur = cur.parentNode ) { - eventPath.push( cur ); - tmp = cur; - } - - // Only add window if we got to document (e.g., not plain obj or detached DOM) - if ( tmp === ( elem.ownerDocument || document ) ) { - eventPath.push( tmp.defaultView || tmp.parentWindow || window ); - } - } - - // Fire handlers on the event path - i = 0; - while ( ( cur = eventPath[ i++ ] ) && !event.isPropagationStopped() ) { - - event.type = i > 1 ? - bubbleType : - special.bindType || type; - - // jQuery handler - handle = ( dataPriv.get( cur, "events" ) || {} )[ event.type ] && - dataPriv.get( cur, "handle" ); - if ( handle ) { - handle.apply( cur, data ); - } - - // Native handler - handle = ontype && cur[ ontype ]; - if ( handle && handle.apply && acceptData( cur ) ) { - event.result = handle.apply( cur, data ); - if ( event.result === false ) { - event.preventDefault(); - } - } - } - event.type = type; - - // If nobody prevented the default action, do it now - if ( !onlyHandlers && !event.isDefaultPrevented() ) { - - if ( ( !special._default || - special._default.apply( eventPath.pop(), data ) === false ) && - acceptData( elem ) ) { - - // Call a native DOM method on the target with the same name as the event. - // Don't do default actions on window, that's where global variables be (#6170) - if ( ontype && jQuery.isFunction( elem[ type ] ) && !jQuery.isWindow( elem ) ) { - - // Don't re-trigger an onFOO event when we call its FOO() method - tmp = elem[ ontype ]; - - if ( tmp ) { - elem[ ontype ] = null; - } - - // Prevent re-triggering of the same event, since we already bubbled it above - jQuery.event.triggered = type; - elem[ type ](); - jQuery.event.triggered = undefined; - - if ( tmp ) { - elem[ ontype ] = tmp; - } - } - } - } - - return event.result; - }, - - // Piggyback on a donor event to simulate a different one - // Used only for `focus(in | out)` events - simulate: function( type, elem, event ) { - var e = jQuery.extend( - new jQuery.Event(), - event, - { - type: type, - isSimulated: true - } - ); - - jQuery.event.trigger( e, null, elem ); - } - -} ); - -jQuery.fn.extend( { - - trigger: function( type, data ) { - return this.each( function() { - jQuery.event.trigger( type, data, this ); - } ); - }, - triggerHandler: function( type, data ) { - var elem = this[ 0 ]; - if ( elem ) { - return jQuery.event.trigger( type, data, elem, true ); - } - } -} ); - - -jQuery.each( ( "blur focus focusin focusout resize scroll click dblclick " + - "mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " + - "change select submit keydown keypress keyup contextmenu" ).split( " " ), - function( i, name ) { - - // Handle event binding - jQuery.fn[ name ] = function( data, fn ) { - return arguments.length > 0 ? - this.on( name, null, data, fn ) : - this.trigger( name ); - }; -} ); - -jQuery.fn.extend( { - hover: function( fnOver, fnOut ) { - return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver ); - } -} ); - - - - -support.focusin = "onfocusin" in window; - - -// Support: Firefox <=44 -// Firefox doesn't have focus(in | out) events -// Related ticket - https://bugzilla.mozilla.org/show_bug.cgi?id=687787 -// -// Support: Chrome <=48 - 49, Safari <=9.0 - 9.1 -// focus(in | out) events fire after focus & blur events, -// which is spec violation - http://www.w3.org/TR/DOM-Level-3-Events/#events-focusevent-event-order -// Related ticket - https://bugs.chromium.org/p/chromium/issues/detail?id=449857 -if ( !support.focusin ) { - jQuery.each( { focus: "focusin", blur: "focusout" }, function( orig, fix ) { - - // Attach a single capturing handler on the document while someone wants focusin/focusout - var handler = function( event ) { - jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ) ); - }; - - jQuery.event.special[ fix ] = { - setup: function() { - var doc = this.ownerDocument || this, - attaches = dataPriv.access( doc, fix ); - - if ( !attaches ) { - doc.addEventListener( orig, handler, true ); - } - dataPriv.access( doc, fix, ( attaches || 0 ) + 1 ); - }, - teardown: function() { - var doc = this.ownerDocument || this, - attaches = dataPriv.access( doc, fix ) - 1; - - if ( !attaches ) { - doc.removeEventListener( orig, handler, true ); - dataPriv.remove( doc, fix ); - - } else { - dataPriv.access( doc, fix, attaches ); - } - } - }; - } ); -} -var location = window.location; - -var nonce = jQuery.now(); - -var rquery = ( /\?/ ); - - - -// Cross-browser xml parsing -jQuery.parseXML = function( data ) { - var xml; - if ( !data || typeof data !== "string" ) { - return null; - } - - // Support: IE 9 - 11 only - // IE throws on parseFromString with invalid input. - try { - xml = ( new window.DOMParser() ).parseFromString( data, "text/xml" ); - } catch ( e ) { - xml = undefined; - } - - if ( !xml || xml.getElementsByTagName( "parsererror" ).length ) { - jQuery.error( "Invalid XML: " + data ); - } - return xml; -}; - - -var - rbracket = /\[\]$/, - rCRLF = /\r?\n/g, - rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i, - rsubmittable = /^(?:input|select|textarea|keygen)/i; - -function buildParams( prefix, obj, traditional, add ) { - var name; - - if ( Array.isArray( obj ) ) { - - // Serialize array item. - jQuery.each( obj, function( i, v ) { - if ( traditional || rbracket.test( prefix ) ) { - - // Treat each array item as a scalar. - add( prefix, v ); - - } else { - - // Item is non-scalar (array or object), encode its numeric index. - buildParams( - prefix + "[" + ( typeof v === "object" && v != null ? i : "" ) + "]", - v, - traditional, - add - ); - } - } ); - - } else if ( !traditional && jQuery.type( obj ) === "object" ) { - - // Serialize object item. - for ( name in obj ) { - buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add ); - } - - } else { - - // Serialize scalar item. - add( prefix, obj ); - } -} - -// Serialize an array of form elements or a set of -// key/values into a query string -jQuery.param = function( a, traditional ) { - var prefix, - s = [], - add = function( key, valueOrFunction ) { - - // If value is a function, invoke it and use its return value - var value = jQuery.isFunction( valueOrFunction ) ? - valueOrFunction() : - valueOrFunction; - - s[ s.length ] = encodeURIComponent( key ) + "=" + - encodeURIComponent( value == null ? "" : value ); - }; - - // If an array was passed in, assume that it is an array of form elements. - if ( Array.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) { - - // Serialize the form elements - jQuery.each( a, function() { - add( this.name, this.value ); - } ); - - } else { - - // If traditional, encode the "old" way (the way 1.3.2 or older - // did it), otherwise encode params recursively. - for ( prefix in a ) { - buildParams( prefix, a[ prefix ], traditional, add ); - } - } - - // Return the resulting serialization - return s.join( "&" ); -}; - -jQuery.fn.extend( { - serialize: function() { - return jQuery.param( this.serializeArray() ); - }, - serializeArray: function() { - return this.map( function() { - - // Can add propHook for "elements" to filter or add form elements - var elements = jQuery.prop( this, "elements" ); - return elements ? jQuery.makeArray( elements ) : this; - } ) - .filter( function() { - var type = this.type; - - // Use .is( ":disabled" ) so that fieldset[disabled] works - return this.name && !jQuery( this ).is( ":disabled" ) && - rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) && - ( this.checked || !rcheckableType.test( type ) ); - } ) - .map( function( i, elem ) { - var val = jQuery( this ).val(); - - if ( val == null ) { - return null; - } - - if ( Array.isArray( val ) ) { - return jQuery.map( val, function( val ) { - return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; - } ); - } - - return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; - } ).get(); - } -} ); - - -var - r20 = /%20/g, - rhash = /#.*$/, - rantiCache = /([?&])_=[^&]*/, - rheaders = /^(.*?):[ \t]*([^\r\n]*)$/mg, - - // #7653, #8125, #8152: local protocol detection - rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/, - rnoContent = /^(?:GET|HEAD)$/, - rprotocol = /^\/\//, - - /* Prefilters - * 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example) - * 2) These are called: - * - BEFORE asking for a transport - * - AFTER param serialization (s.data is a string if s.processData is true) - * 3) key is the dataType - * 4) the catchall symbol "*" can be used - * 5) execution will start with transport dataType and THEN continue down to "*" if needed - */ - prefilters = {}, - - /* Transports bindings - * 1) key is the dataType - * 2) the catchall symbol "*" can be used - * 3) selection will start with transport dataType and THEN go to "*" if needed - */ - transports = {}, - - // Avoid comment-prolog char sequence (#10098); must appease lint and evade compression - allTypes = "*/".concat( "*" ), - - // Anchor tag for parsing the document origin - originAnchor = document.createElement( "a" ); - originAnchor.href = location.href; - -// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport -function addToPrefiltersOrTransports( structure ) { - - // dataTypeExpression is optional and defaults to "*" - return function( dataTypeExpression, func ) { - - if ( typeof dataTypeExpression !== "string" ) { - func = dataTypeExpression; - dataTypeExpression = "*"; - } - - var dataType, - i = 0, - dataTypes = dataTypeExpression.toLowerCase().match( rnothtmlwhite ) || []; - - if ( jQuery.isFunction( func ) ) { - - // For each dataType in the dataTypeExpression - while ( ( dataType = dataTypes[ i++ ] ) ) { - - // Prepend if requested - if ( dataType[ 0 ] === "+" ) { - dataType = dataType.slice( 1 ) || "*"; - ( structure[ dataType ] = structure[ dataType ] || [] ).unshift( func ); - - // Otherwise append - } else { - ( structure[ dataType ] = structure[ dataType ] || [] ).push( func ); - } - } - } - }; -} - -// Base inspection function for prefilters and transports -function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) { - - var inspected = {}, - seekingTransport = ( structure === transports ); - - function inspect( dataType ) { - var selected; - inspected[ dataType ] = true; - jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) { - var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR ); - if ( typeof dataTypeOrTransport === "string" && - !seekingTransport && !inspected[ dataTypeOrTransport ] ) { - - options.dataTypes.unshift( dataTypeOrTransport ); - inspect( dataTypeOrTransport ); - return false; - } else if ( seekingTransport ) { - return !( selected = dataTypeOrTransport ); - } - } ); - return selected; - } - - return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" ); -} - -// A special extend for ajax options -// that takes "flat" options (not to be deep extended) -// Fixes #9887 -function ajaxExtend( target, src ) { - var key, deep, - flatOptions = jQuery.ajaxSettings.flatOptions || {}; - - for ( key in src ) { - if ( src[ key ] !== undefined ) { - ( flatOptions[ key ] ? target : ( deep || ( deep = {} ) ) )[ key ] = src[ key ]; - } - } - if ( deep ) { - jQuery.extend( true, target, deep ); - } - - return target; -} - -/* Handles responses to an ajax request: - * - finds the right dataType (mediates between content-type and expected dataType) - * - returns the corresponding response - */ -function ajaxHandleResponses( s, jqXHR, responses ) { - - var ct, type, finalDataType, firstDataType, - contents = s.contents, - dataTypes = s.dataTypes; - - // Remove auto dataType and get content-type in the process - while ( dataTypes[ 0 ] === "*" ) { - dataTypes.shift(); - if ( ct === undefined ) { - ct = s.mimeType || jqXHR.getResponseHeader( "Content-Type" ); - } - } - - // Check if we're dealing with a known content-type - if ( ct ) { - for ( type in contents ) { - if ( contents[ type ] && contents[ type ].test( ct ) ) { - dataTypes.unshift( type ); - break; - } - } - } - - // Check to see if we have a response for the expected dataType - if ( dataTypes[ 0 ] in responses ) { - finalDataType = dataTypes[ 0 ]; - } else { - - // Try convertible dataTypes - for ( type in responses ) { - if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[ 0 ] ] ) { - finalDataType = type; - break; - } - if ( !firstDataType ) { - firstDataType = type; - } - } - - // Or just use first one - finalDataType = finalDataType || firstDataType; - } - - // If we found a dataType - // We add the dataType to the list if needed - // and return the corresponding response - if ( finalDataType ) { - if ( finalDataType !== dataTypes[ 0 ] ) { - dataTypes.unshift( finalDataType ); - } - return responses[ finalDataType ]; - } -} - -/* Chain conversions given the request and the original response - * Also sets the responseXXX fields on the jqXHR instance - */ -function ajaxConvert( s, response, jqXHR, isSuccess ) { - var conv2, current, conv, tmp, prev, - converters = {}, - - // Work with a copy of dataTypes in case we need to modify it for conversion - dataTypes = s.dataTypes.slice(); - - // Create converters map with lowercased keys - if ( dataTypes[ 1 ] ) { - for ( conv in s.converters ) { - converters[ conv.toLowerCase() ] = s.converters[ conv ]; - } - } - - current = dataTypes.shift(); - - // Convert to each sequential dataType - while ( current ) { - - if ( s.responseFields[ current ] ) { - jqXHR[ s.responseFields[ current ] ] = response; - } - - // Apply the dataFilter if provided - if ( !prev && isSuccess && s.dataFilter ) { - response = s.dataFilter( response, s.dataType ); - } - - prev = current; - current = dataTypes.shift(); - - if ( current ) { - - // There's only work to do if current dataType is non-auto - if ( current === "*" ) { - - current = prev; - - // Convert response if prev dataType is non-auto and differs from current - } else if ( prev !== "*" && prev !== current ) { - - // Seek a direct converter - conv = converters[ prev + " " + current ] || converters[ "* " + current ]; - - // If none found, seek a pair - if ( !conv ) { - for ( conv2 in converters ) { - - // If conv2 outputs current - tmp = conv2.split( " " ); - if ( tmp[ 1 ] === current ) { - - // If prev can be converted to accepted input - conv = converters[ prev + " " + tmp[ 0 ] ] || - converters[ "* " + tmp[ 0 ] ]; - if ( conv ) { - - // Condense equivalence converters - if ( conv === true ) { - conv = converters[ conv2 ]; - - // Otherwise, insert the intermediate dataType - } else if ( converters[ conv2 ] !== true ) { - current = tmp[ 0 ]; - dataTypes.unshift( tmp[ 1 ] ); - } - break; - } - } - } - } - - // Apply converter (if not an equivalence) - if ( conv !== true ) { - - // Unless errors are allowed to bubble, catch and return them - if ( conv && s.throws ) { - response = conv( response ); - } else { - try { - response = conv( response ); - } catch ( e ) { - return { - state: "parsererror", - error: conv ? e : "No conversion from " + prev + " to " + current - }; - } - } - } - } - } - } - - return { state: "success", data: response }; -} - -jQuery.extend( { - - // Counter for holding the number of active queries - active: 0, - - // Last-Modified header cache for next request - lastModified: {}, - etag: {}, - - ajaxSettings: { - url: location.href, - type: "GET", - isLocal: rlocalProtocol.test( location.protocol ), - global: true, - processData: true, - async: true, - contentType: "application/x-www-form-urlencoded; charset=UTF-8", - - /* - timeout: 0, - data: null, - dataType: null, - username: null, - password: null, - cache: null, - throws: false, - traditional: false, - headers: {}, - */ - - accepts: { - "*": allTypes, - text: "text/plain", - html: "text/html", - xml: "application/xml, text/xml", - json: "application/json, text/javascript" - }, - - contents: { - xml: /\bxml\b/, - html: /\bhtml/, - json: /\bjson\b/ - }, - - responseFields: { - xml: "responseXML", - text: "responseText", - json: "responseJSON" - }, - - // Data converters - // Keys separate source (or catchall "*") and destination types with a single space - converters: { - - // Convert anything to text - "* text": String, - - // Text to html (true = no transformation) - "text html": true, - - // Evaluate text as a json expression - "text json": JSON.parse, - - // Parse text as xml - "text xml": jQuery.parseXML - }, - - // For options that shouldn't be deep extended: - // you can add your own custom options here if - // and when you create one that shouldn't be - // deep extended (see ajaxExtend) - flatOptions: { - url: true, - context: true - } - }, - - // Creates a full fledged settings object into target - // with both ajaxSettings and settings fields. - // If target is omitted, writes into ajaxSettings. - ajaxSetup: function( target, settings ) { - return settings ? - - // Building a settings object - ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) : - - // Extending ajaxSettings - ajaxExtend( jQuery.ajaxSettings, target ); - }, - - ajaxPrefilter: addToPrefiltersOrTransports( prefilters ), - ajaxTransport: addToPrefiltersOrTransports( transports ), - - // Main method - ajax: function( url, options ) { - - // If url is an object, simulate pre-1.5 signature - if ( typeof url === "object" ) { - options = url; - url = undefined; - } - - // Force options to be an object - options = options || {}; - - var transport, - - // URL without anti-cache param - cacheURL, - - // Response headers - responseHeadersString, - responseHeaders, - - // timeout handle - timeoutTimer, - - // Url cleanup var - urlAnchor, - - // Request state (becomes false upon send and true upon completion) - completed, - - // To know if global events are to be dispatched - fireGlobals, - - // Loop variable - i, - - // uncached part of the url - uncached, - - // Create the final options object - s = jQuery.ajaxSetup( {}, options ), - - // Callbacks context - callbackContext = s.context || s, - - // Context for global events is callbackContext if it is a DOM node or jQuery collection - globalEventContext = s.context && - ( callbackContext.nodeType || callbackContext.jquery ) ? - jQuery( callbackContext ) : - jQuery.event, - - // Deferreds - deferred = jQuery.Deferred(), - completeDeferred = jQuery.Callbacks( "once memory" ), - - // Status-dependent callbacks - statusCode = s.statusCode || {}, - - // Headers (they are sent all at once) - requestHeaders = {}, - requestHeadersNames = {}, - - // Default abort message - strAbort = "canceled", - - // Fake xhr - jqXHR = { - readyState: 0, - - // Builds headers hashtable if needed - getResponseHeader: function( key ) { - var match; - if ( completed ) { - if ( !responseHeaders ) { - responseHeaders = {}; - while ( ( match = rheaders.exec( responseHeadersString ) ) ) { - responseHeaders[ match[ 1 ].toLowerCase() ] = match[ 2 ]; - } - } - match = responseHeaders[ key.toLowerCase() ]; - } - return match == null ? null : match; - }, - - // Raw string - getAllResponseHeaders: function() { - return completed ? responseHeadersString : null; - }, - - // Caches the header - setRequestHeader: function( name, value ) { - if ( completed == null ) { - name = requestHeadersNames[ name.toLowerCase() ] = - requestHeadersNames[ name.toLowerCase() ] || name; - requestHeaders[ name ] = value; - } - return this; - }, - - // Overrides response content-type header - overrideMimeType: function( type ) { - if ( completed == null ) { - s.mimeType = type; - } - return this; - }, - - // Status-dependent callbacks - statusCode: function( map ) { - var code; - if ( map ) { - if ( completed ) { - - // Execute the appropriate callbacks - jqXHR.always( map[ jqXHR.status ] ); - } else { - - // Lazy-add the new callbacks in a way that preserves old ones - for ( code in map ) { - statusCode[ code ] = [ statusCode[ code ], map[ code ] ]; - } - } - } - return this; - }, - - // Cancel the request - abort: function( statusText ) { - var finalText = statusText || strAbort; - if ( transport ) { - transport.abort( finalText ); - } - done( 0, finalText ); - return this; - } - }; - - // Attach deferreds - deferred.promise( jqXHR ); - - // Add protocol if not provided (prefilters might expect it) - // Handle falsy url in the settings object (#10093: consistency with old signature) - // We also use the url parameter if available - s.url = ( ( url || s.url || location.href ) + "" ) - .replace( rprotocol, location.protocol + "//" ); - - // Alias method option to type as per ticket #12004 - s.type = options.method || options.type || s.method || s.type; - - // Extract dataTypes list - s.dataTypes = ( s.dataType || "*" ).toLowerCase().match( rnothtmlwhite ) || [ "" ]; - - // A cross-domain request is in order when the origin doesn't match the current origin. - if ( s.crossDomain == null ) { - urlAnchor = document.createElement( "a" ); - - // Support: IE <=8 - 11, Edge 12 - 13 - // IE throws exception on accessing the href property if url is malformed, - // e.g. http://example.com:80x/ - try { - urlAnchor.href = s.url; - - // Support: IE <=8 - 11 only - // Anchor's host property isn't correctly set when s.url is relative - urlAnchor.href = urlAnchor.href; - s.crossDomain = originAnchor.protocol + "//" + originAnchor.host !== - urlAnchor.protocol + "//" + urlAnchor.host; - } catch ( e ) { - - // If there is an error parsing the URL, assume it is crossDomain, - // it can be rejected by the transport if it is invalid - s.crossDomain = true; - } - } - - // Convert data if not already a string - if ( s.data && s.processData && typeof s.data !== "string" ) { - s.data = jQuery.param( s.data, s.traditional ); - } - - // Apply prefilters - inspectPrefiltersOrTransports( prefilters, s, options, jqXHR ); - - // If request was aborted inside a prefilter, stop there - if ( completed ) { - return jqXHR; - } - - // We can fire global events as of now if asked to - // Don't fire events if jQuery.event is undefined in an AMD-usage scenario (#15118) - fireGlobals = jQuery.event && s.global; - - // Watch for a new set of requests - if ( fireGlobals && jQuery.active++ === 0 ) { - jQuery.event.trigger( "ajaxStart" ); - } - - // Uppercase the type - s.type = s.type.toUpperCase(); - - // Determine if request has content - s.hasContent = !rnoContent.test( s.type ); - - // Save the URL in case we're toying with the If-Modified-Since - // and/or If-None-Match header later on - // Remove hash to simplify url manipulation - cacheURL = s.url.replace( rhash, "" ); - - // More options handling for requests with no content - if ( !s.hasContent ) { - - // Remember the hash so we can put it back - uncached = s.url.slice( cacheURL.length ); - - // If data is available, append data to url - if ( s.data ) { - cacheURL += ( rquery.test( cacheURL ) ? "&" : "?" ) + s.data; - - // #9682: remove data so that it's not used in an eventual retry - delete s.data; - } - - // Add or update anti-cache param if needed - if ( s.cache === false ) { - cacheURL = cacheURL.replace( rantiCache, "$1" ); - uncached = ( rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + ( nonce++ ) + uncached; - } - - // Put hash and anti-cache on the URL that will be requested (gh-1732) - s.url = cacheURL + uncached; - - // Change '%20' to '+' if this is encoded form body content (gh-2658) - } else if ( s.data && s.processData && - ( s.contentType || "" ).indexOf( "application/x-www-form-urlencoded" ) === 0 ) { - s.data = s.data.replace( r20, "+" ); - } - - // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. - if ( s.ifModified ) { - if ( jQuery.lastModified[ cacheURL ] ) { - jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] ); - } - if ( jQuery.etag[ cacheURL ] ) { - jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] ); - } - } - - // Set the correct header, if data is being sent - if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) { - jqXHR.setRequestHeader( "Content-Type", s.contentType ); - } - - // Set the Accepts header for the server, depending on the dataType - jqXHR.setRequestHeader( - "Accept", - s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[ 0 ] ] ? - s.accepts[ s.dataTypes[ 0 ] ] + - ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) : - s.accepts[ "*" ] - ); - - // Check for headers option - for ( i in s.headers ) { - jqXHR.setRequestHeader( i, s.headers[ i ] ); - } - - // Allow custom headers/mimetypes and early abort - if ( s.beforeSend && - ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || completed ) ) { - - // Abort if not done already and return - return jqXHR.abort(); - } - - // Aborting is no longer a cancellation - strAbort = "abort"; - - // Install callbacks on deferreds - completeDeferred.add( s.complete ); - jqXHR.done( s.success ); - jqXHR.fail( s.error ); - - // Get transport - transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR ); - - // If no transport, we auto-abort - if ( !transport ) { - done( -1, "No Transport" ); - } else { - jqXHR.readyState = 1; - - // Send global event - if ( fireGlobals ) { - globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] ); - } - - // If request was aborted inside ajaxSend, stop there - if ( completed ) { - return jqXHR; - } - - // Timeout - if ( s.async && s.timeout > 0 ) { - timeoutTimer = window.setTimeout( function() { - jqXHR.abort( "timeout" ); - }, s.timeout ); - } - - try { - completed = false; - transport.send( requestHeaders, done ); - } catch ( e ) { - - // Rethrow post-completion exceptions - if ( completed ) { - throw e; - } - - // Propagate others as results - done( -1, e ); - } - } - - // Callback for when everything is done - function done( status, nativeStatusText, responses, headers ) { - var isSuccess, success, error, response, modified, - statusText = nativeStatusText; - - // Ignore repeat invocations - if ( completed ) { - return; - } - - completed = true; - - // Clear timeout if it exists - if ( timeoutTimer ) { - window.clearTimeout( timeoutTimer ); - } - - // Dereference transport for early garbage collection - // (no matter how long the jqXHR object will be used) - transport = undefined; - - // Cache response headers - responseHeadersString = headers || ""; - - // Set readyState - jqXHR.readyState = status > 0 ? 4 : 0; - - // Determine if successful - isSuccess = status >= 200 && status < 300 || status === 304; - - // Get response data - if ( responses ) { - response = ajaxHandleResponses( s, jqXHR, responses ); - } - - // Convert no matter what (that way responseXXX fields are always set) - response = ajaxConvert( s, response, jqXHR, isSuccess ); - - // If successful, handle type chaining - if ( isSuccess ) { - - // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. - if ( s.ifModified ) { - modified = jqXHR.getResponseHeader( "Last-Modified" ); - if ( modified ) { - jQuery.lastModified[ cacheURL ] = modified; - } - modified = jqXHR.getResponseHeader( "etag" ); - if ( modified ) { - jQuery.etag[ cacheURL ] = modified; - } - } - - // if no content - if ( status === 204 || s.type === "HEAD" ) { - statusText = "nocontent"; - - // if not modified - } else if ( status === 304 ) { - statusText = "notmodified"; - - // If we have data, let's convert it - } else { - statusText = response.state; - success = response.data; - error = response.error; - isSuccess = !error; - } - } else { - - // Extract error from statusText and normalize for non-aborts - error = statusText; - if ( status || !statusText ) { - statusText = "error"; - if ( status < 0 ) { - status = 0; - } - } - } - - // Set data for the fake xhr object - jqXHR.status = status; - jqXHR.statusText = ( nativeStatusText || statusText ) + ""; - - // Success/Error - if ( isSuccess ) { - deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] ); - } else { - deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] ); - } - - // Status-dependent callbacks - jqXHR.statusCode( statusCode ); - statusCode = undefined; - - if ( fireGlobals ) { - globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError", - [ jqXHR, s, isSuccess ? success : error ] ); - } - - // Complete - completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] ); - - if ( fireGlobals ) { - globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] ); - - // Handle the global AJAX counter - if ( !( --jQuery.active ) ) { - jQuery.event.trigger( "ajaxStop" ); - } - } - } - - return jqXHR; - }, - - getJSON: function( url, data, callback ) { - return jQuery.get( url, data, callback, "json" ); - }, - - getScript: function( url, callback ) { - return jQuery.get( url, undefined, callback, "script" ); - } -} ); - -jQuery.each( [ "get", "post" ], function( i, method ) { - jQuery[ method ] = function( url, data, callback, type ) { - - // Shift arguments if data argument was omitted - if ( jQuery.isFunction( data ) ) { - type = type || callback; - callback = data; - data = undefined; - } - - // The url can be an options object (which then must have .url) - return jQuery.ajax( jQuery.extend( { - url: url, - type: method, - dataType: type, - data: data, - success: callback - }, jQuery.isPlainObject( url ) && url ) ); - }; -} ); - - -jQuery._evalUrl = function( url ) { - return jQuery.ajax( { - url: url, - - // Make this explicit, since user can override this through ajaxSetup (#11264) - type: "GET", - dataType: "script", - cache: true, - async: false, - global: false, - "throws": true - } ); -}; - - -jQuery.fn.extend( { - wrapAll: function( html ) { - var wrap; - - if ( this[ 0 ] ) { - if ( jQuery.isFunction( html ) ) { - html = html.call( this[ 0 ] ); - } - - // The elements to wrap the target around - wrap = jQuery( html, this[ 0 ].ownerDocument ).eq( 0 ).clone( true ); - - if ( this[ 0 ].parentNode ) { - wrap.insertBefore( this[ 0 ] ); - } - - wrap.map( function() { - var elem = this; - - while ( elem.firstElementChild ) { - elem = elem.firstElementChild; - } - - return elem; - } ).append( this ); - } - - return this; - }, - - wrapInner: function( html ) { - if ( jQuery.isFunction( html ) ) { - return this.each( function( i ) { - jQuery( this ).wrapInner( html.call( this, i ) ); - } ); - } - - return this.each( function() { - var self = jQuery( this ), - contents = self.contents(); - - if ( contents.length ) { - contents.wrapAll( html ); - - } else { - self.append( html ); - } - } ); - }, - - wrap: function( html ) { - var isFunction = jQuery.isFunction( html ); - - return this.each( function( i ) { - jQuery( this ).wrapAll( isFunction ? html.call( this, i ) : html ); - } ); - }, - - unwrap: function( selector ) { - this.parent( selector ).not( "body" ).each( function() { - jQuery( this ).replaceWith( this.childNodes ); - } ); - return this; - } -} ); - - -jQuery.expr.pseudos.hidden = function( elem ) { - return !jQuery.expr.pseudos.visible( elem ); -}; -jQuery.expr.pseudos.visible = function( elem ) { - return !!( elem.offsetWidth || elem.offsetHeight || elem.getClientRects().length ); -}; - - - - -jQuery.ajaxSettings.xhr = function() { - try { - return new window.XMLHttpRequest(); - } catch ( e ) {} -}; - -var xhrSuccessStatus = { - - // File protocol always yields status code 0, assume 200 - 0: 200, - - // Support: IE <=9 only - // #1450: sometimes IE returns 1223 when it should be 204 - 1223: 204 - }, - xhrSupported = jQuery.ajaxSettings.xhr(); - -support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported ); -support.ajax = xhrSupported = !!xhrSupported; - -jQuery.ajaxTransport( function( options ) { - var callback, errorCallback; - - // Cross domain only allowed if supported through XMLHttpRequest - if ( support.cors || xhrSupported && !options.crossDomain ) { - return { - send: function( headers, complete ) { - var i, - xhr = options.xhr(); - - xhr.open( - options.type, - options.url, - options.async, - options.username, - options.password - ); - - // Apply custom fields if provided - if ( options.xhrFields ) { - for ( i in options.xhrFields ) { - xhr[ i ] = options.xhrFields[ i ]; - } - } - - // Override mime type if needed - if ( options.mimeType && xhr.overrideMimeType ) { - xhr.overrideMimeType( options.mimeType ); - } - - // X-Requested-With header - // For cross-domain requests, seeing as conditions for a preflight are - // akin to a jigsaw puzzle, we simply never set it to be sure. - // (it can always be set on a per-request basis or even using ajaxSetup) - // For same-domain requests, won't change header if already provided. - if ( !options.crossDomain && !headers[ "X-Requested-With" ] ) { - headers[ "X-Requested-With" ] = "XMLHttpRequest"; - } - - // Set headers - for ( i in headers ) { - xhr.setRequestHeader( i, headers[ i ] ); - } - - // Callback - callback = function( type ) { - return function() { - if ( callback ) { - callback = errorCallback = xhr.onload = - xhr.onerror = xhr.onabort = xhr.onreadystatechange = null; - - if ( type === "abort" ) { - xhr.abort(); - } else if ( type === "error" ) { - - // Support: IE <=9 only - // On a manual native abort, IE9 throws - // errors on any property access that is not readyState - if ( typeof xhr.status !== "number" ) { - complete( 0, "error" ); - } else { - complete( - - // File: protocol always yields status 0; see #8605, #14207 - xhr.status, - xhr.statusText - ); - } - } else { - complete( - xhrSuccessStatus[ xhr.status ] || xhr.status, - xhr.statusText, - - // Support: IE <=9 only - // IE9 has no XHR2 but throws on binary (trac-11426) - // For XHR2 non-text, let the caller handle it (gh-2498) - ( xhr.responseType || "text" ) !== "text" || - typeof xhr.responseText !== "string" ? - { binary: xhr.response } : - { text: xhr.responseText }, - xhr.getAllResponseHeaders() - ); - } - } - }; - }; - - // Listen to events - xhr.onload = callback(); - errorCallback = xhr.onerror = callback( "error" ); - - // Support: IE 9 only - // Use onreadystatechange to replace onabort - // to handle uncaught aborts - if ( xhr.onabort !== undefined ) { - xhr.onabort = errorCallback; - } else { - xhr.onreadystatechange = function() { - - // Check readyState before timeout as it changes - if ( xhr.readyState === 4 ) { - - // Allow onerror to be called first, - // but that will not handle a native abort - // Also, save errorCallback to a variable - // as xhr.onerror cannot be accessed - window.setTimeout( function() { - if ( callback ) { - errorCallback(); - } - } ); - } - }; - } - - // Create the abort callback - callback = callback( "abort" ); - - try { - - // Do send the request (this may raise an exception) - xhr.send( options.hasContent && options.data || null ); - } catch ( e ) { - - // #14683: Only rethrow if this hasn't been notified as an error yet - if ( callback ) { - throw e; - } - } - }, - - abort: function() { - if ( callback ) { - callback(); - } - } - }; - } -} ); - - - - -// Prevent auto-execution of scripts when no explicit dataType was provided (See gh-2432) -jQuery.ajaxPrefilter( function( s ) { - if ( s.crossDomain ) { - s.contents.script = false; - } -} ); - -// Install script dataType -jQuery.ajaxSetup( { - accepts: { - script: "text/javascript, application/javascript, " + - "application/ecmascript, application/x-ecmascript" - }, - contents: { - script: /\b(?:java|ecma)script\b/ - }, - converters: { - "text script": function( text ) { - jQuery.globalEval( text ); - return text; - } - } -} ); - -// Handle cache's special case and crossDomain -jQuery.ajaxPrefilter( "script", function( s ) { - if ( s.cache === undefined ) { - s.cache = false; - } - if ( s.crossDomain ) { - s.type = "GET"; - } -} ); - -// Bind script tag hack transport -jQuery.ajaxTransport( "script", function( s ) { - - // This transport only deals with cross domain requests - if ( s.crossDomain ) { - var script, callback; - return { - send: function( _, complete ) { - script = jQuery( " + + + + + + + + + + + + + + + + + + + + + + + + + +
+ + + +
+ + + + + +
+ +
+ + + + + + + + + + + + + + + + + +
+ + + + +
+
+
+
+ +
+

Creating New Maps

+

Creating a new map in porymap is easy! Just click Tools -> New Map…. +Alternatively, in any of the map list sort modes, you can right click on a folder +in order to add a new map to the folder.

+

For example, when sorting maps by their layout, you can add a new Pokemon Center from the existing layout.

+
+Add New Map with Layout +

Add New Map with Layout

+
+
+

New Map Options

+

The popup window when you create a new map will display some options in order to customize your new map.

+
+New Map Options Window +

New Map Options Window

+
+

The options you see may be different depending on your base project, but they are:

+
+
Name

The name of the new map. This cannot be changed in porymap.

+
+
Group

Which map group the new map will beling to. This cannot be changed in porymap.

+
+
Map Width

The width (in metatiles) of the map. This can be changed in porymap.

+
+
Map Height

The height (in metatiles) of the map. This can be changed in porymap.

+
+
Border Width

The width (in metatiles) of the map border blocks. This can be changed in porymap.

+
+
Border Height

The height (in metatiles) of the map border blocks. This can be changed in porymap.

+
+
Primary Tileset

The map’s primary tileset. This can be changed in porymap.

+
+
Secondary Tileset

The map’s secondary tileset. This can be changed in porymap.

+
+
Type

Whether this map is an indoor or outdoor map. This can be changed in porymap.

+
+
Location

The region map section this map exists in. This can be changed in porymap.

+
+
Can Fly To

Whether a heal location event will be created with this map. This cannot be changed in porymap.

+
+
Allow Running

Whether the player can sprint on this map. This can be changed in porymap.

+
+
Allow Biking

Whether the player can use the bike on this map. This can be changed in porymap.

+
+
Allow Escape Rope

Whether the user can escape from this map. This can be changed in porymap.

+
+
Floor Number

The floor number for this map if it is associated with an elevator. This can be changed in porymap.

+
+
+
+
+ + +
+ +
+ + +
+
+ +
+ +
+ + + + + + + + + + + + \ No newline at end of file diff --git a/docs/manual/editing-map-collisions.html b/docs/manual/editing-map-collisions.html index 40e72ab1..55193762 100644 --- a/docs/manual/editing-map-collisions.html +++ b/docs/manual/editing-map-collisions.html @@ -123,6 +123,7 @@
  • Sign Event
  • Hidden Item Event
  • Secret Base Event
  • +
  • Heal Location / Healspots
  • Adding & Deleting Events
  • Open Map Scripts
  • @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor
    • Background Image Tab
    • Map Layout Tab
    • @@ -300,7 +305,7 @@ Map Events View

      Map Events View

      -

      All of the events are visible on the map. The Event Details window on the right displays the properties of the currently-selected event. If you look closely, you’ll see that the woman NPC near the Pokémon Center has a pink border around it because it’s selected. To select a different event, simple click on an event in the map area. Alternatively, you can use the spinner at the top of the event properties window. Multiple events can be selected at the same time by holding Ctrl and clicking another event.

      +

      All of the events are visible on the map. The Event Details window on the right displays the properties of the currently-selected event. If you look closely, you’ll see that the woman NPC near the Pokémon Center has a pink border around it because it’s selected. To select a different event, simply click on an event in the map area. Alternatively, you can use the spinner at the top of the event properties window. Multiple events can be selected at the same time by holding Ctrl and clicking another event.

      Event Id Spinner

      Event Id Spinner

      @@ -339,10 +344,12 @@
      Event Flag

      The flag value that controls if the object is visible. If the flag is set (equal to 1), then the object will be invisible. If the Event Flag is set to 0, then the object will always be visible because 0 means “no flag”.

      -
      Trainer Type

      NONE, NORMAL, or SEE ALL DIRECTIONS. If the object is a trainer, NORMAL means that the trainer will spot the player in the object’s line-of-sight.

      +
      Trainer Type

      The trainer type used by the object. If the object is a trainer, TRAINER_TYPE_NORMAL means that the trainer will spot the player in the object’s line-of-sight.

      Sight Radius or Berry Tree ID

      If the object is a trainer, this property control how many tiles the trainer can see to spot the player for battle. If the object is a berry tree, this specifies the global id of the berry tree. Each berry tree in the game has a unique berry tree id.

      +
      In Connection

      Exclusive to pokefirered. Used to replace objects that are visible in a map’s connection with their corresponding object on the connecting map. When checked, these objects will make odd use of other fields; its trainer type value will be the connecting map number, its Sight Radius / Berry Tree Id will be the connecting map group, and its z coordinate will be the object’s local id on the connecting map.

      +
      @@ -381,7 +388,7 @@

      Weather Trigger Events

      -

      Weather trigger events are a very specific type of trigger. When the player walks over a weather trigger, the overworld’s weather will transition to the specified weather type.

      +

      Weather trigger events are a very specific type of trigger. When the player walks over a weather trigger, the overworld’s weather will transition to the specified weather type. This event type is unavailable for pokefirered projects; the functions to trigger weather changes were dummied out.

      Weather Trigger Event Properties

      Weather Trigger Event Properties

      @@ -423,11 +430,16 @@
      Flag

      This flag is set when the player receives the hidden item.

      +
      Quantity

      Exclusive to pokefirered. The number of items received when the item is picked up.

      +
      +
      Requires Itemfinder

      Exclusive to pokefirered. When checked, the hidden item can only be received by standing on it and using the Itemfinder.

      +

      Secret Base Event

      -

      This is the event used to mark entrances to secret bases. This event will only be functional on certain metatiles. Unfortunately, they are hardcoded into the game’s engine (see sSecretBaseEntranceMetatiles in src/secret_base.c).

      +

      This is the event used to mark entrances to secret bases. This event will only be functional on certain metatiles. Unfortunately, they are hardcoded into the game’s engine (see sSecretBaseEntranceMetatiles in src/secret_base.c). +This event type is unavailable for pokefirered projects; secret bases do not exist there.

      Secret Base Event Properties

      Secret Base Event Properties

      @@ -439,6 +451,20 @@
      +
      +

      Heal Location / Healspots

      +

      This event is used to control where a player will arrive when they white out or fly to the map. The white out functions a little differently between game versions. For pokeemerald and pokeruby players will arrive at the event’s coordinates after a white out, while in pokefirered they will arrive on the map set in Respawn Map and at hardcoded coordinates (see SetWhiteoutRespawnWarpAndHealerNpc in src/heal_location.c).

      +
      +Heal Location Properties +

      Heal Location Properties

      +
      +
      +
      Respawn Map

      Exclusive to pokefirered. The map where the player will arrive when they white out (e.g. inside the PokéCenter that the heal location is in front of).

      +
      +
      Respawn NPC

      Exclusive to pokefirered. The local id of the NPC the player will interact with when they white out.

      +
      +
      +

      Adding & Deleting Events

      To add a new event, press the green plus button. add-event-button You can choose between the different types of events by clicking the small arrow on the right.

      diff --git a/docs/manual/editing-map-header.html b/docs/manual/editing-map-header.html index 63e38272..509a490c 100644 --- a/docs/manual/editing-map-header.html +++ b/docs/manual/editing-map-header.html @@ -123,6 +123,7 @@
    • Sign Event
    • Hidden Item Event
    • Secret Base Event
    • +
    • Heal Location / Healspots
    • Adding & Deleting Events
    • Open Map Scripts
    @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor
    • Background Image Tab
    • Map Layout Tab
    • @@ -309,7 +314,7 @@
      Weather

      The weather that is running when entering the map.

      -
      Type

      The type of map. This value is used by various things in the game engine. For example, in Ruby Version, running shoes can only be used when the map type is MAP_TYPE_INDOOR.

      +
      Type

      The type of map. This value is used by various things in the game engine. For example, in Ruby Version, running shoes cannot be used when the map type is MAP_TYPE_INDOOR.

      Battle Scene

      Controls what graphics are used in battles.

      @@ -319,7 +324,9 @@
      Allow Biking

      Controls whether or not a bike can be used.

      -
      Allow Dig & Escape Rop

      Controls whether the Dig field move or the Escape Rope item can be used.

      +
      Allow Dig & Escape Rope

      Controls whether the Dig field move or the Escape Rope item can be used.

      +
      +
      Floor Number

      Exclusive to pokefirered. Used to append a number to the map name popup. Negative values are prefixed with “B” for basement, and floor 127 is “Rooftop”.

      Custom Fields

      You can enter custom fields if you need support for additional fields in your project. They can also be useful for keeping notes.

      diff --git a/docs/manual/editing-map-tiles.html b/docs/manual/editing-map-tiles.html index 9c451d25..f64d78ea 100644 --- a/docs/manual/editing-map-tiles.html +++ b/docs/manual/editing-map-tiles.html @@ -123,6 +123,7 @@
    • Sign Event
    • Hidden Item Event
    • Secret Base Event
    • +
    • Heal Location / Healspots
    • Adding & Deleting Events
    • Open Map Scripts
    @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor
    • Background Image Tab
    • Map Layout Tab
    • @@ -389,6 +394,7 @@ Change Map Border

      Change Map Border

      +

      The dimensions of the map’s border can also be adjusted for pokefirered projects via the Change Dimensions button. If you have modified your pokeemerald or pokeruby project to support custom border sizes you can enable this option with the use_custom_border_size field in your project’s porymap.project.cfg file.

      Change Map Tilesets

      diff --git a/docs/manual/editing-wild-encounters.html b/docs/manual/editing-wild-encounters.html index d3dc5241..09c4017e 100644 --- a/docs/manual/editing-wild-encounters.html +++ b/docs/manual/editing-wild-encounters.html @@ -36,7 +36,7 @@ - + @@ -123,6 +123,7 @@
    • Sign Event
    • Hidden Item Event
    • Secret Base Event
    • +
    • Heal Location / Healspots
    • Adding & Deleting Events
    • Open Map Scripts
    @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor
    • Background Image Tab
    • Map Layout Tab
    • @@ -312,6 +317,7 @@
      Sort by Layout

      Organizes by map layouts. Most layouts are only used by a single map, but layouts like the Pokemon Center are used by many maps.

      +

      Right-clicking on the folder name in any of the sort modes will bring up a dialog to create a new map in that folder. For more details, see: Creating New Maps.

      The Expand All expand-all-button and Collapse All collapse-all-button buttons will expand or collapse all of the map folders.

      Type in the filter to show maps that contain the filter text.

      @@ -349,7 +355,7 @@

      Region Map Editor

      -

      The Region Map Editor can be opened with File -> Region Map Editor. This window will allow you to modify the look and layout of maps on the game’s region map. You can also modify the city map images using the bottom two panes.

      +

      The Region Map Editor can be opened with File -> Region Map Editor. This window will allow you to modify the look and layout of maps on the game’s region map. You can also modify the city map images using the bottom two panes. Currently the Region Map Editor is only available for pokeemerald and pokeruby projects.

      Region Map Editor

      Region Map Editor

      diff --git a/docs/manual/project-files.html b/docs/manual/project-files.html index a6df97bc..77162d96 100644 --- a/docs/manual/project-files.html +++ b/docs/manual/project-files.html @@ -123,6 +123,7 @@
    • Sign Event
    • Hidden Item Event
    • Secret Base Event
    • +
    • Heal Location / Healspots
    • Adding & Deleting Events
    • Open Map Scripts
    @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor
    • Background Image Tab
    • Map Layout Tab
    • @@ -353,22 +358,22 @@ to a file, it probably is not a good idea to edit yourself unless otherwise note

      yes

      -

      src/data/field_event_obj/event_object_graphics_info_pointers.h

      +

      src/data/object_events/object_event_graphics_info_pointers.h

      yes

      no

      -

      src/data/field_event_obj/event_object_graphics_info.h

      +

      src/data/object_events/object_event_graphics_info.h

      yes

      no

      -

      src/data/field_event_obj/event_object_pic_tables.h

      +

      src/data/object_events/object_event_pic_tables.h

      yes

      no

      -

      src/data/field_event_obj/event_object_graphics.h

      +

      src/data/object_events/object_event_graphics.h

      yes

      no

      @@ -428,37 +433,37 @@ to a file, it probably is not a good idea to edit yourself unless otherwise note

      no

      -

      include/constants/secret_bases.h

      +

      include/constants/trainer_types.h

      yes

      no

      -

      include/constants/event_object_movement_constants.h

      +

      include/constants/secret_bases.h

      +

      yes

      +

      no

      +

      pokeemerald and pokeruby only

      + +

      include/constants/event_object_movement.h

      yes

      no

      -

      include/constants/bg_event_constants.h

      +

      include/constants/event_bg.h

      yes

      no

      -

      include/constants/region_map_sections.h

      +

      include/constants/region_map_sections.h

      yes

      no

      -

      include/constants/metatile_labels.h

      +

      include/constants/metatile_labels.h

      yes

      yes

      -

      include/constants/metatile_behaviors.h

      -

      yes

      -

      no

      - - -

      include/constants/bg_event_constants.h

      +

      include/constants/metatile_behaviors.h

      yes

      no

      diff --git a/docs/manual/region-map-editor.html b/docs/manual/region-map-editor.html index 4b2120e6..cabc295a 100644 --- a/docs/manual/region-map-editor.html +++ b/docs/manual/region-map-editor.html @@ -37,7 +37,7 @@ - + @@ -123,6 +123,7 @@
    • Sign Event
    • Hidden Item Event
    • Secret Base Event
    • +
    • Heal Location / Healspots
    • Adding & Deleting Events
    • Open Map Scripts
    @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor
    • Background Image Tab
    • Map Layout Tab
    • @@ -297,6 +302,10 @@

      The Region Map Editor

      This is where you edit the region map for your game. To open the region map editor, navigate to Tools -> Region Map Editor from porymap’s main window.

      +
      +

      Note

      +

      The region map editor is currently only available for pokeemerald and pokeruby.

      +

      When you first open the region map editor, your window will look like this:

      RME Window @@ -407,7 +416,7 @@ but that functionality will be added in a future update.

      - +
      diff --git a/docs/manual/scripting-capabilities.html b/docs/manual/scripting-capabilities.html index 742458cd..68ad531a 100644 --- a/docs/manual/scripting-capabilities.html +++ b/docs/manual/scripting-capabilities.html @@ -123,6 +123,7 @@
    • Sign Event
    • Hidden Item Event
    • Secret Base Event
    • +
    • Heal Location / Healspots
    • Adding & Deleting Events
    • Open Map Scripts
    @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor
    • Background Image Tab
    • Map Layout Tab
    • @@ -367,7 +372,7 @@

      Scripting API

      Callbacks

      -
      +
      onProjectOpened(projectPath)

      Called when Porymap successfully opens a project.

      @@ -380,7 +385,7 @@
      -
      +
      onProjectClosed(projectPath)

      Called when Porymap closes a project. For example, this is called when opening a different project.

      @@ -393,7 +398,7 @@
      -
      +
      onMapOpened(mapName)

      Called when a map is opened.

      @@ -406,7 +411,7 @@
      -
      +
      onBlockChanged(x, y, prevBlock, newBlock)

      Called when a block is changed on the map. For example, this is called when a user paints a new tile or changes the collision property of a block.

      @@ -429,7 +434,7 @@

      Map Editing Functions

      The following functions are related to editing the map’s blocks or retrieving information about them.

      -
      +
      map.getBlock(x, y)

      Gets a block in the currently-opened map.

      @@ -446,7 +451,7 @@
      -
      +
      map.setBlock(x, y, metatileId, collision, elevation)

      Sets a block in the currently-opened map.

      @@ -463,7 +468,7 @@
      -
      +
      map.getMetatileId(x, y)

      Gets the metatile id of a block in the currently-opened map.

      @@ -480,7 +485,7 @@
      -
      +
      map.setMetatileId(x, y, metatileId)

      Sets the metatile id of a block in the currently-opened map.

      @@ -495,7 +500,7 @@
      -
      +
      map.getCollision(x, y)

      Gets the collision of a block in the currently-opened map. (0 = passable, 1 = impassable)

      @@ -512,7 +517,7 @@
      -
      +
      map.setCollision(x, y, collision)

      Sets the collision of a block in the currently-opened map. (0 = passable, 1 = impassable)

      @@ -527,7 +532,7 @@
      -
      +
      map.getElevation(x, y)

      Gets the elevation of a block in the currently-opened map.

      @@ -544,7 +549,7 @@
      -
      +
      map.setElevation(x, y, elevation)

      Sets the elevation of a block in the currently-opened map.

      @@ -559,7 +564,7 @@
      -
      +
      map.setBlocksFromSelection(x, y)

      Sets blocks on the map using the user’s current metatile selection.

      @@ -573,7 +578,7 @@
      -
      +
      map.bucketFill(x, y, metatileId)

      Performs a bucket fill of a metatile id, starting at the given coordinates.

      @@ -588,7 +593,7 @@
      -
      +
      map.bucketFillFromSelection(x, y)

      Performs a bucket fill using the user’s current metatile selection, starting at the given coordinates.

      @@ -602,7 +607,7 @@
      -
      +
      map.magicFill(x, y, metatileId)

      Performs a magic fill of a metatile id, starting at the given coordinates.

      @@ -617,7 +622,7 @@
      -
      +
      map.magicFillFromSelection(x, y)

      Performs a magic fill using the user’s current metatile selection, starting at the given coordinates.

      @@ -631,7 +636,7 @@
      -
      +
      map.shift(xDelta, yDelta)

      Performs a shift on the map’s blocks.

      @@ -645,7 +650,7 @@
      -
      +
      map.getDimensions()

      Gets the dimensions of the currently-opened map.

      @@ -656,7 +661,7 @@
      -
      +
      map.getWidth()

      Gets the width of the currently-opened map.

      @@ -667,7 +672,7 @@
      -
      +
      map.getHeight()

      Gets the height of the currently-opened map.

      @@ -678,7 +683,7 @@
      -
      +
      map.setDimensions(width, height)

      Sets the dimensions of the currently-opened map.

      @@ -692,7 +697,7 @@
      -
      +
      map.setWidth(width)

      Sets the width of the currently-opened map.

      @@ -705,7 +710,7 @@
      -
      +
      map.setHeight()

      Sets the height of the currently-opened map.

      @@ -722,13 +727,13 @@

      Map Overlay Functions

      The following functions are related to an overlay that is drawn on top of the map area. Text, images, and shapes can be drawn using these functions.

      -
      +
      map.clearOverlay()

      Clears and erases all overlay items that were previously-added to the map.

      -
      +
      map.addText(text, x, y, color = "#000000", size = 12)

      Adds a text item to the overlay.

      @@ -745,7 +750,7 @@
      -
      +
      map.addRect(x, y, width, height, color = "#000000")

      Adds a rectangle outline item to the overlay.

      @@ -762,7 +767,7 @@
      -
      +
      map.addFilledRect(x, y, width, height, color = "#000000")

      Adds a filled rectangle item to the overlay.

      @@ -779,7 +784,7 @@
      -
      +
      map.addImage(x, y, filepath)

      Adds an image item to the overlay.

      @@ -798,7 +803,7 @@

      Tileset Functions

      The following functions are related to tilesets and their palettes. The functions with “preview” in their name operate on a “fake” version of the palette colors. This means that changing these “preview” colors won’t affect the actual tileset colors in the project. A good use of the “preview” palettes would be Day/Night tints, for example.

      -
      +
      map.getPrimaryTilesetPalettePreview(paletteIndex)

      Gets a palette from the primary tileset of the currently-opened map.

      @@ -814,7 +819,7 @@
      -
      +
      map.setPrimaryTilesetPalettePreview(paletteIndex, colors)

      Sets a palette in the primary tileset of the currently-opened map. This will NOT affect the true underlying colors–it only displays these colors in the map-editing area of Porymap.

      @@ -828,7 +833,7 @@
      -
      +
      map.getPrimaryTilesetPalettesPreview()

      Gets all of the palettes from the primary tileset of the currently-opened map.

      @@ -839,7 +844,7 @@
      -
      +
      map.setPrimaryTilesetPalettesPreview(palettes)

      Sets all of the palettes in the primary tileset of the currently-opened map. This will NOT affect the true underlying colors–it only displays these colors in the map-editing area of Porymap.

      @@ -852,7 +857,7 @@
      -
      +
      map.getSecondaryTilesetPalettePreview(paletteIndex)

      Gets a palette from the secondary tileset of the currently-opened map.

      @@ -868,7 +873,7 @@
      -
      +
      map.setSecondaryTilesetPalettePreview(paletteIndex, colors)

      Sets a palette in the secondary tileset of the currently-opened map. This will NOT affect the true underlying colors–it only displays these colors in the map-editing area of Porymap.

      @@ -882,7 +887,7 @@
      -
      +
      map.getSecondaryTilesetPalettesPreview()

      Gets all of the palettes from the secondary tileset of the currently-opened map.

      @@ -893,7 +898,7 @@
      -
      +
      map.setSecondaryTilesetPalettesPreview(palettes)

      Sets all of the palettes in the secondary tileset of the currently-opened map. This will NOT affect the true underlying colors–it only displays these colors in the map-editing area of Porymap.

      @@ -906,7 +911,7 @@
      -
      +
      map.getPrimaryTilesetPalette(paletteIndex)

      Gets a palette from the primary tileset of the currently-opened map.

      @@ -922,7 +927,7 @@
      -
      +
      map.setPrimaryTilesetPalette(paletteIndex, colors)

      Sets a palette in the primary tileset of the currently-opened map. This will permanently affect the palette and save the palette to disk.

      @@ -936,7 +941,7 @@
      -
      +
      map.getPrimaryTilesetPalettes()

      Gets all of the palettes from the primary tileset of the currently-opened map.

      @@ -947,7 +952,7 @@
      -
      +
      map.setPrimaryTilesetPalettes(palettes)

      Sets all of the palettes in the primary tileset of the currently-opened map. This will permanently affect the palettes and save the palettes to disk.

      @@ -960,7 +965,7 @@
      -
      +
      map.getSecondaryTilesetPalette(paletteIndex)

      Gets a palette from the secondary tileset of the currently-opened map.

      @@ -976,7 +981,7 @@
      -
      +
      map.setSecondaryTilesetPalette(paletteIndex, colors)

      Sets a palette in the secondary tileset of the currently-opened map. This will permanently affect the palette and save the palette to disk.

      @@ -990,7 +995,7 @@
      -
      +
      map.getSecondaryTilesetPalettes()

      Gets all of the palettes from the secondary tileset of the currently-opened map.

      @@ -1001,7 +1006,7 @@
      -
      +
      map.setSecondaryTilesetPalettes(palettes)

      Sets all of the palettes in the secondary tileset of the currently-opened map. This will permanently affect the palettes and save the palettes to disk.

      @@ -1014,7 +1019,7 @@
      -
      +
      map.getPrimaryTileset()

      Gets the name of the primary tileset for the currently-opened map.

      @@ -1025,7 +1030,7 @@
      -
      +
      map.setPrimaryTileset(tileset)

      Sets the primary tileset for the currently-opened map.

      @@ -1038,7 +1043,7 @@
      -
      +
      map.getSecondaryTileset()

      Gets the name of the secondary tileset for the currently-opened map.

      @@ -1049,7 +1054,7 @@
      -
      +
      map.setSecondaryTileset(tileset)

      Sets the secondary tileset for the currently-opened map.

      @@ -1066,7 +1071,7 @@

      Settings Functions

      The following functions are related to settings.

      -
      +
      map.getGridVisibility()

      Gets the visibility of the map grid overlay.

      @@ -1077,7 +1082,7 @@
      -
      +
      map.setGridVisibility(visible)

      Sets the visibility of the map grid overlay.

      @@ -1090,7 +1095,7 @@
      -
      +
      map.getBorderVisibility()

      Gets the visibility of the map’s border.

      @@ -1101,7 +1106,7 @@
      -
      +
      map.setBorderVisibility(visible)

      Sets the visibility of the map’s border.

      @@ -1114,7 +1119,7 @@
      -
      +
      map.getSmartPathsEnabled()

      Gets the toggle state of smart paths.

      @@ -1125,7 +1130,7 @@
      -
      +
      map.setSmartPathsEnabled(enabled)

      Sets the toggle state of smart paths.

      @@ -1142,7 +1147,7 @@

      Utility Functions

      These are some miscellaneous functions that can be very useful when building custom scripts.

      -
      +
      map.registerAction(functionName, actionName, shortcut = "")

      Registers a JavaScript function to an action that can be manually triggered in Porymap’s Tools menu. Optionally, a keyboard shortcut (e.g. "Ctrl+P") can also be specified, assuming it doesn’t collide with any existing shortcuts used by Porymap.

      @@ -1157,7 +1162,7 @@
      -
      +
      map.setTimeout(func, delayMs)

      This behaves essentially the same as JavaScript’s setTimeout() that is used in web browsers or NodeJS. The func argument is a JavaScript function (NOT the name of a function) which will be executed after a delay. This is useful for creating animations or refreshing the overlay at constant intervals.

      @@ -1171,7 +1176,7 @@
      -
      +
      map.log(message)

      Logs a message to the Porymap log file. This is useful for debugging custom scripts.

      diff --git a/docs/objects.inv b/docs/objects.inv index 3d2b8871..15252854 100644 Binary files a/docs/objects.inv and b/docs/objects.inv differ diff --git a/docs/reference/changelog.html b/docs/reference/changelog.html index c790ccfc..7ac4812d 100644 --- a/docs/reference/changelog.html +++ b/docs/reference/changelog.html @@ -123,6 +123,7 @@
    • Sign Event
    • Hidden Item Event
    • Secret Base Event
    • +
    • Heal Location / Healspots
    • Adding & Deleting Events
    • Open Map Scripts
    @@ -139,6 +140,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor @@ -138,6 +139,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor @@ -138,6 +139,10 @@
  • Configuring the Wild Encounter Fields
  • +
  • Creating New Maps +
  • The Region Map Editor
    • Background Image Tab
    • Map Layout Tab
    • diff --git a/docs/searchindex.js b/docs/searchindex.js index 2bade5a1..8880858d 100644 --- a/docs/searchindex.js +++ b/docs/searchindex.js @@ -1 +1 @@ -Search.setIndex({docnames:["index","manual/editing-map-collisions","manual/editing-map-connections","manual/editing-map-events","manual/editing-map-header","manual/editing-map-tiles","manual/editing-wild-encounters","manual/introduction","manual/navigation","manual/project-files","manual/region-map-editor","manual/scripting-capabilities","reference/changelog","reference/related-projects"],envversion:{"sphinx.domains.c":1,"sphinx.domains.changeset":1,"sphinx.domains.citation":1,"sphinx.domains.cpp":1,"sphinx.domains.index":1,"sphinx.domains.javascript":1,"sphinx.domains.math":2,"sphinx.domains.python":1,"sphinx.domains.rst":1,"sphinx.domains.std":1,sphinx:56},filenames:["index.rst","manual\\editing-map-collisions.rst","manual\\editing-map-connections.rst","manual\\editing-map-events.rst","manual\\editing-map-header.rst","manual\\editing-map-tiles.rst","manual\\editing-wild-encounters.rst","manual\\introduction.rst","manual\\navigation.rst","manual\\project-files.rst","manual\\region-map-editor.rst","manual\\scripting-capabilities.rst","reference\\changelog.md","reference\\related-projects.rst"],objects:{"":{onBlockChanged:[11,0,1,""],onMapOpened:[11,0,1,""],onProjectClosed:[11,0,1,""],onProjectOpened:[11,0,1,""]},map:{addFilledRect:[11,0,1,""],addImage:[11,0,1,""],addRect:[11,0,1,""],addText:[11,0,1,""],bucketFill:[11,0,1,""],bucketFillFromSelection:[11,0,1,""],clearOverlay:[11,0,1,""],getBlock:[11,0,1,""],getBorderVisibility:[11,0,1,""],getCollision:[11,0,1,""],getDimensions:[11,0,1,""],getElevation:[11,0,1,""],getGridVisibility:[11,0,1,""],getHeight:[11,0,1,""],getMetatileId:[11,0,1,""],getPrimaryTileset:[11,0,1,""],getPrimaryTilesetPalette:[11,0,1,""],getPrimaryTilesetPalettePreview:[11,0,1,""],getPrimaryTilesetPalettes:[11,0,1,""],getPrimaryTilesetPalettesPreview:[11,0,1,""],getSecondaryTileset:[11,0,1,""],getSecondaryTilesetPalette:[11,0,1,""],getSecondaryTilesetPalettePreview:[11,0,1,""],getSecondaryTilesetPalettes:[11,0,1,""],getSecondaryTilesetPalettesPreview:[11,0,1,""],getSmartPathsEnabled:[11,0,1,""],getWidth:[11,0,1,""],log:[11,0,1,""],magicFill:[11,0,1,""],magicFillFromSelection:[11,0,1,""],registerAction:[11,0,1,""],setBlock:[11,0,1,""],setBlocksFromSelection:[11,0,1,""],setBorderVisibility:[11,0,1,""],setCollision:[11,0,1,""],setDimensions:[11,0,1,""],setElevation:[11,0,1,""],setGridVisibility:[11,0,1,""],setHeight:[11,0,1,""],setMetatileId:[11,0,1,""],setPrimaryTileset:[11,0,1,""],setPrimaryTilesetPalette:[11,0,1,""],setPrimaryTilesetPalettePreview:[11,0,1,""],setPrimaryTilesetPalettes:[11,0,1,""],setPrimaryTilesetPalettesPreview:[11,0,1,""],setSecondaryTileset:[11,0,1,""],setSecondaryTilesetPalette:[11,0,1,""],setSecondaryTilesetPalettePreview:[11,0,1,""],setSecondaryTilesetPalettes:[11,0,1,""],setSecondaryTilesetPalettesPreview:[11,0,1,""],setSmartPathsEnabled:[11,0,1,""],setTimeout:[11,0,1,""],setWidth:[11,0,1,""],shift:[11,0,1,""]}},objnames:{"0":["js","function","JavaScript function"]},objtypes:{"0":"js:function"},terms:{"0e8ccfc4fd3544001f4c25fafd401f7558bdefba":12,"0x10":11,"0x11":11,"0x4":7,"0x8":11,"0x9":11,"3x3":5,"82abc164dc9f6a74fdf0c535cc1621b7ed05318b":12,"8x8":10,"boolean":11,"case":[1,3],"const":11,"default":[3,5,6,8,11,12],"export":[11,12],"final":7,"function":[3,7,10],"import":[1,10,11,12],"int":[],"long":[1,12],"new":[0,1,2,3,9,10,11,12],"pok\u00e9mon":[3,5,8],"return":11,"switch":8,"true":[1,11],"try":[1,11],"var":[3,9],"while":[1,5,10,11],AND:3,Adding:0,For:[1,2,4,5,6,11],Its:[7,12],NOT:11,One:[6,11],That:7,The:[0,1,3,4,5,6,7,8,11,12],Then:[1,6,11],There:[3,7,10],These:[1,2,5,6,10,11],Use:[3,5],With:11,a0ba1b7c6353f7e4f3066025514c05b323a0123d:12,a1ea3b5e394bc115ba9b86348c161094a00dcca7:12,aarrggbb:11,abil:[1,3,11,12],abl:[1,3,11],about:[0,11,12],abov:[1,3,5,7,8,10,11,12],accept:6,access:11,accomod:12,accomplish:5,accord:12,account:10,accur:12,act:12,action:[0,5],actionnam:11,activ:6,actual:[11,12],ad365a35c1536740cbcbc10bee66e5dd908c39e7:12,adb0a444577b59eb02788c782a3d04bc285be0ba:12,add:[2,3,6,10,11,12],added:[10,11],addfilledrect:11,addimag:11,adding:[6,10],addit:[4,7,11],addition:5,addrect:11,addtext:11,adher:12,adjust:6,advanc:[7,12,13],affect:[10,11],after:[1,5,7,11],again:3,all:[1,2,3,5,6,8,10,11,12],allow:[1,4,5,6,7,8,11,12],along:1,also:[1,3,4,5,6,8,9,10,11,12],alter:6,altern:3,alwai:[1,3],ani:[1,3,5,11,12],anim:11,anoth:[3,5,6,8],anyth:[3,5],api:0,appear:[5,8,10,12],append:9,appli:11,applic:[8,12],applymov:3,applynighttint:11,appropri:1,area:[1,3,5,7,8,10,11,12],argument:11,around:[3,5,8,10,12],arrai:11,arrow:3,asdf:[],asdfasd:[],assign:[3,6],associ:[1,3,10],assum:11,auto:12,autocomplet:12,automat:[2,3,4,11],avail:[5,6,7,8],awai:6,awar:5,back:5,background:[0,4,8],base:[0,6,12],base_game_vers:12,basic:[1,5,7,8],battl:[3,4],becaus:[1,3,8,10],been:12,befor:[1,5,7,10,11,12],begin:10,behav:[11,12],behavior:12,being:[1,7,12],belong:4,below:[1,5,6,11,12],berri:3,between:[1,2,3,8,12],beyond:12,bg_event_const:9,bigger:5,bike:4,binari:[7,10],black:11,blank:10,blasdkfa:[],block:[1,11],blockdata:9,blue:3,boi:13,border:[0,3,9,11],both:[2,12],bottom:[5,8,10,12],bound:[3,12],boundari:12,box:[6,10],bread:5,bridg:1,briefli:8,bring:[3,6],browser:11,brush:11,bucket:[0,11],bucketfil:11,bucketfillfromselect:11,bug:12,build:[3,7,11],built:12,bulk:12,bump:12,butter:5,button:[2,3,5,6,7,8,10,12],bvd:12,c68ba9f4e8e260f2e3389eccd15f6ee5f4bdcd3:12,c73de8bed752ca538d90cfc93c4a9e8c7965f8c9:12,call:[5,11],callabl:11,callback:[],can:[0,1,2,3,4,5,6,7,8,10,11,12],capabl:[0,12],caus:12,cave:6,cdae0c1444bed98e652c87dc3e3edcecacfef8b:12,ceil:11,center:[3,5,8],certain:[3,9,12],cfg:[11,12],chanc:6,chang:[0,2,6,7,8,10,11],changelog:0,charact:[3,12],check:[5,6,11],checkbox:[2,5,12],choos:[3,5,6,7,8,11],citi:[0,2,7,8],clear:[10,11],clearoverlai:11,click:[1,2,3,5,6,7,8,10,11,12],cliff:1,close:[3,11,12],code:11,collaps:[8,12],collect:4,collid:11,collis:[0,3,7,8,11,12],color:[10,11,12,13],column:1,com:[0,12],combin:8,combobox:[10,12],comma:11,command:3,comment:12,commit:12,common:1,commonli:1,compil:7,compos:10,comprehens:12,concept:1,config:[11,12],configur:[0,11,12],connect:[0,5,7,8,12],consist:12,constant:[9,10,11],contain:[8,12],context:8,contigu:[5,12],continu:1,control:[1,3,4,7],conveni:[5,12],coordin:[3,10,11],copi:[5,6,12],corner:[2,11],correctli:12,correspond:[10,12],corrupt:12,could:[11,12],count:1,coupl:11,cover:[3,8],crash:12,creat:[6,11,12],cross:7,ctrl:[2,3,5,7,10,11,12],cumbersom:11,current:[1,3,5,6,7,8,10,11,12],cursor:[5,10],custom:[0,4,10,12],custom_script:11,dai:[6,11],dark:12,data:[6,7,9,10,12],date:12,daunt:8,debug:11,decomil:[],decompil:[7,12,13],defin:[10,11,12],delai:11,delaym:11,delet:[0,2,10,12],demand:11,demonstr:5,denot:1,depend:[5,12],describ:6,desir:[2,5,8],despit:12,destin:[2,3],detail:[3,5,10],detect:11,determin:[1,3,10],diagonist:11,dialog:7,did:12,diff:12,differ:[1,3,5,8,10,11,12],difficulti:7,dig:4,dimens:[10,11],direct:[1,2,3,12],directori:11,disabl:[5,6,12],disallow:12,disassembl:13,disk:[6,11],displai:[3,5,6,7,11,12],dissect:3,dive:0,document:[11,12],doe:[5,7],doesn:[1,5,11],doing:7,don:[2,12],done:10,doubl:[2,3,8,12],down:[5,6,7,12],download:7,drag:[2,3,5,10,12],draw:[7,10,12],drawn:11,drop:6,dropdown:[2,5],due:12,duplic:12,dure:[1,3,12],dynam:3,each:[1,3,4,6,8,10,11,12],easi:[3,5],easier:[5,12],easiest:2,east:[1,2],ecmascript:11,edit:[0,7,8,9,10,12],editor:[0,3,7,12,13],either:[1,5,8,11],element:11,elev:[1,3,11],els:[1,3],emerg:0,empti:[6,7,12],enabl:[2,5,11,12],encount:[0,12],end:[9,12],endless:11,enforc:6,engin:[3,4],enhanc:11,ensur:3,enter:[1,3,4,8,10],entir:[5,10,11,12],entranc:3,entri:0,equal:3,equival:7,eras:11,error:[11,12],escap:4,essenti:11,etc:12,even:5,event:[0,2,7,8,11,12],event_object_graph:9,event_object_graphics_info:9,event_object_graphics_info_point:9,event_object_movement_const:9,event_object_pic_t:9,event_script:9,everi:[5,8],exactli:5,exampl:[1,2,3,4,5,10,11],except:[1,3],execut:[3,11],exist:[5,7,11,12],expand:[4,8,12],explain:3,explanatori:4,explicitli:12,explor:1,extend:12,extens:[3,11,12],extra:12,extrem:2,eyedropp:5,face:[3,12],fake:11,familiar:7,fan:12,featur:[1,2,7,8],feel:0,few:[5,7,8],fewer:10,field:[0,4,12],field_event_obj:9,fieldmap:9,file:[0,2,3,7,8,10,11,12],filepath:11,fill:[0,1,11,12],filter:8,find:0,finish:1,first:[1,3,6,7,8,10,11],fix:[5,10],flag:[3,9,12],flash:4,flip:12,floor:11,flow:[1,5],flower:7,floweri:7,folder:[7,8,12],follow:[0,7,11],font:11,fork:11,format:[5,12,13],found:[7,12],four:6,frlg:12,from:[1,3,5,6,7,8,9,10,11,12,13],front:3,full:12,fullest:8,func:11,functionnam:11,futur:10,game:[1,3,4,5,6,7,8,10,12,13],gameplai:[1,3,8],gen:[7,13],gener:[1,7,9,11],get:[0,5,11],getblock:11,getbordervis:11,getcollis:11,getdimens:11,getelev:11,getgridvis:11,getheight:11,getmetatileid:11,getprimarytileset:11,getprimarytilesetpalett:11,getprimarytilesetpalettepreview:11,getprimarytilesetpalettespreview:11,getsecondarytileset:11,getsecondarytilesetpalett:11,getsecondarytilesetpalettepreview:11,getsecondarytilesetpalettespreview:11,getsmartpathsen:11,getwidth:11,gif:5,git:[3,7],github:[0,12],give:[6,8],given:[6,11],global:[3,11],goe:11,going:3,good:[9,11],gpl:12,graphic:[4,9,12],grass:[1,7,11],grasstil:11,great:7,green:[3,6],greet:7,grid:[5,11,12],group:[0,8,12],grow:12,guarante:12,hack:7,half:[1,10],handl:12,happen:[3,11,12],hardcod:[3,12],has:[1,2,3,4,8,12],have:[1,2,3,5,6,7,8,10,11,12],head:10,headbutt_mon:6,header:[0,8,9,12],heal:12,heal_loc:9,height:[10,11],help:[5,12],here:[1,11],hexadecim:1,hidden:[0,12],hide:4,hierarch:8,high:13,highli:7,higlight:10,histori:1,hit:12,hold:[3,5,12],hop:1,horizont:[2,11],hous:12,hover:[5,12],how:[1,3,5,7,8,11],howev:[3,11],http:[0,12],huderlem:[0,12],icon:[5,9,12],idea:9,ident:[1,5],ignor:7,illustr:[1,5],imag:[0,3,5,8,9,11,12],impass:[1,11],implement:6,implicitli:11,improperli:12,improv:7,inc:[3,9,12],includ:[1,3,5,6,8,9,10],incorrect:12,index:[6,10,11,12],indexof:11,indic:5,individu:12,inform:[11,12],initi:[11,12],insert:[10,11],instal:7,instanc:10,instead:11,integ:12,integr:[9,12],interact:[1,3,8,11],interest:11,interpret:12,interv:11,introduc:12,introduct:0,invalid:12,invis:3,involv:3,issu:12,item:[0,4,9,11,12],iter:12,its:[3,5],itself:11,jasc:12,javascript:[11,12],json:[6,9,12],jump:12,junk:12,just:[1,5,6],kanto:12,keep:[2,4,12],kei:[5,12],keyboard:[11,12],known:3,label:12,laid:5,land:1,languag:13,larg:[5,12],larger:8,last:12,later:11,launch:[7,11],layer:12,layout:[0,8,9,12],layouts_t:12,learn:[5,7,8],leav:1,left:[1,5,7,8,10,11],length:11,let:[1,3,5,6,7,8,10,11,13],level:[1,6,9,13],life:[3,5],like:[1,3,5,8,10,12],limit:4,line:[3,12],link:10,linux:7,list:[0,9,12],listen:13,load:[7,8,11],local:3,locat:[4,5,7,10,12],log:[11,12],logic:11,longer:[3,12],look:[0,3,7,8,10],mac:[7,12],maco:12,made:[6,10,12],magic:[11,12],magicfil:11,magicfillfromselect:11,mai:[3,6],main:[0,5,6,7,10],maintain:[1,9],major:12,make:[1,3,5,7,10,12],mani:[3,7,8],manipul:6,manual:[0,11],map:[0,6,7,9,12,13],map_group:9,map_groups_count:12,map_typ:9,map_type_indoor:4,mapnam:11,mapsec_new_mapsec:10,mapsec_non:10,mark:3,match:[3,5,12],math:11,max:[9,11,12],maximum:6,mean:[1,2,3,11],meant:13,menu:[2,6,11,12],messag:11,metatil:[0,1,3,7,8,9,11,12],metatile_behavior:9,metatile_label:9,metatileid:11,method:5,middl:5,might:[6,11],millisecond:11,mimic:12,min:[9,11,12],minimum:6,minor:12,mirror:0,miscellan:[4,11],miss:[0,12],mistak:[5,10],mode:12,modif:1,modifi:[5,8,10,11,12],monitor:12,more:[3,5,7,8,10,12],most:[1,7,8],mostli:4,mountain:[1,5],mous:[5,10,12],move:[1,2,3,4,12],movement:[3,12],much:7,multi:[1,12],multilin:12,multipl:[3,5,6,11,12],music:[4,8,13],must:[2,3,5,6,7,10],my_script:11,name:[3,4,6,8,9,10,11,12],navig:[0,2,3,6,7,10,12],nearli:1,need:[1,2,3,4,5,12],never:3,newblock:11,newli:12,next:[1,3,6,7,8,11,12],nice:11,night:11,nodej:11,nodep:7,non:3,none:3,normal:3,north:1,notabl:[7,12],note:[4,9],noth:3,notic:10,now:[1,5,6,7,11,12],npc:3,number:[1,6,11,12],object:[0,1,8,11,12],occur:[11,12],off:[1,5,12],offici:12,offset:[2,12],old:12,on_block_chang:[],onblockchang:11,onc:[3,5],one:[1,2,5,6,8],onli:[1,2,3,4,5,6,8,9,10,11,12],onmapopen:11,onprojectclos:11,onprojectopen:11,onto:[1,5,8,10,11],open:[0,2,6,7,8,10,11,12],oper:[8,11],option:[0,8,11,12],order:[3,6,10,12],organ:8,origin:[3,10],other:[3,5,8,11,12,13],otherwis:[6,9,11],our:[6,7,11],out:[0,5,6,10,11,12],outlin:[5,11,12],outsid:12,over:[1,3,4,5,8],overhaul:12,overlai:[],overview:11,overworld:3,overwrit:11,own:10,paint:[0,5,7,8,10,11,12],pal:12,palett:[9,10,11,12],paletteindex:11,pane:[5,8,10,12],panel:[7,12],paramet:[],pars:12,part:8,partial:12,particular:1,passabl:11,patch:11,path:[0,1,11,12],pathwai:5,patient:8,pattern:[5,11],pencil:[0,7,12],perform:[5,11],perman:11,petalburg:[2,7],pick:3,picker:5,pictur:6,pink:3,pixel:[10,11],place:[5,7,10,11],plai:4,platform:7,player:[1,2,3,5,8,10,12],pleas:0,plu:[2,3],png:12,pointer:[0,12],pokecryst:13,pokeemerald:[7,12],pokefir:[11,12],pokemon:[6,8,9,12],poker:13,pokerubi:[7,12],polish:13,pond:5,pop:7,popul:[6,10],popular:13,popup:[4,10],portion:5,porymap:[2,3,5,6,8,9,10,11,12],poryscript:[12,13],posit:[0,5,10],possibl:[6,10,11,12],power:[5,11],pre:12,prefix:12,press:[2,3,7,8,10,12],pret:[7,12],pretti:6,prevblock:11,prevent:12,preview:[5,11],previou:1,previous:11,primari:[5,7,8,11],probabl:[9,11],procedur:11,process:1,program:13,project:[0,4,7,8,11,12],projectpath:11,prompt:12,properli:12,properti:[1,3,4,7,8,11,12],provid:[5,6,7,11,12],pull:12,purpos:[1,8],quick:5,quickli:8,radiu:[3,5],randint:11,random:11,rang:3,rate:6,rather:[5,12],ratio:6,raw:10,rawvalu:11,reach:0,read:[7,9,12],reason:6,receiv:3,recommend:7,rectangl:[5,11,12],red:[1,6],redo:[0,1,3,7,10],refer:0,refresh:11,region:[0,4,5,7,12],region_map:[9,10],region_map_entri:[9,10],region_map_sect:[9,10],regist:0,registeract:11,registri:12,regress:12,regular:5,rejoic:12,relat:[0,9,11],releas:[7,12],reli:9,reload:12,rememb:[1,11],render:12,repo:12,report:12,repres:[1,6],requir:[3,4,10,12],reset:10,resili:12,resiz:[5,12],respect:[7,12],rest:11,restor:12,result:7,retriev:11,rgb:11,right:[1,2,3,5,6,8,10,12],rival:3,rme:10,rom:7,rop:4,rope:4,rout:[1,2],row:[1,12],rrggbb:11,rubi:4,run:[4,11],same:[1,3,5,7,10,11,12],save:[2,5,6,7,11,12],scenario:12,scene:4,screen:[6,7],script:[0,8,9,12,13],scroll:5,seamlessli:2,second:[1,7,8],secondari:[5,8,11],secret:[0,12],secret_bas:[3,9],section:[3,4,8,10],see:[3,5,6,7,11],seem:8,seen:12,select:[0,2,3,6,7,8,10,11,12],selector:[1,10,12],self:4,semant:12,sensibl:12,separ:11,session:12,set:[3,5,6,8,10,12],setblock:11,setblocksfromselect:11,setbordervis:11,setcollis:11,setdimens:11,setelev:11,setgridvis:11,setheight:11,setmetatileid:11,setprimarytileset:11,setprimarytilesetpalett:11,setprimarytilesetpalettepreview:11,setprimarytilesetpalettespreview:11,setsecondarytileset:11,setsecondarytilesetpalett:11,setsecondarytilesetpalettepreview:11,setsecondarytilesetpalettespreview:11,setsmartpathsen:11,settimeout:11,setup:7,setwidth:11,sever:[6,11],shape:11,share:10,shift:[0,2,11,12],shoe:4,shortcut:[1,5,7,11,12],should:[1,3,5,6,7,11],shouldn:7,show:[4,5,7,8,11,12],shrink:12,side:[1,2,5,7,8],sight:3,sign:[0,12],signpost:[1,3],similar:[1,2,6],simpl:[3,6],simpli:[2,5,8,10],simplifi:5,sinc:[2,7,11,12],singl:[6,8,10],situat:8,size:[10,11,12],slider:[1,5,10,12],slot:6,small:3,smart:[0,1,11,12],smooth:12,snap:5,some:[1,3,5,7,8,11],someth:[0,1,3,6],sometim:12,somewhat:12,song:4,sort:[8,12],sourc:7,south:1,span:10,speci:6,special:[1,3],specif:[3,12],specifi:[3,11,12],spinbox:10,spinner:[3,12],split:10,spot:3,sprite:[3,9,12],squar:[3,10,12],src:[3,9,10],ssecretbaseentrancemetatil:3,stai:12,stair:1,start:[0,1,10,11],startup:12,state:11,statu:12,still:12,stitch:12,store:10,straightforward:6,strict:10,string:[11,12],studio:13,successfulli:[7,11],summar:8,support:[4,7,11,12],sure:[1,2,7],surf:1,surround:[5,8],swap:10,sync:2,system:12,tab:[0,1,2,3,6,8,12],tabl:12,take:[5,6,7,8,10,11],technic:[3,11],test:11,text:[1,3,8,11],than:[5,12],thei:[2,3,4,5,8],them:[1,2,3,4,6,11,12],theme:12,therefor:[6,7,10],thi:[1,2,3,4,5,6,8,9,10,11,12],thing:[3,4,5,6,7,8],think:[5,7],those:7,though:[5,12],three:[3,10],through:[1,2,12],tied:10,tile:[0,1,3,7,8,9,10,11,12],tilemap:13,tileset:[0,7,9,12],time:[1,3,5,6,7,8,11,12],tint:11,togeth:2,toggl:[5,11,12],too:[1,12],tool:[0,1,7,10,11,12],toolbar:[5,7],top:[1,2,3,10,11,12],total:[1,6],tpl:12,tradit:7,trainer:[3,12],trainer_sight_or_berry_tree_id:12,trainer_typ:12,transit:[1,3],transpar:[1,12],tree:[3,5],trigger:[0,8,11],two:[2,5,8,10],type:[0,3,4,8,10,12],typic:[1,3],unabl:1,under:[1,10],underli:[11,12],undertand:1,underw:12,undo:[0,1,3,7,10],unfortun:3,unhappi:10,uniq:6,uniqu:3,unless:9,unlik:1,unreleas:0,unsav:12,until:6,updat:[1,2,5,10,12],upstream:12,usabl:7,use:[1,3,5,6,7,8,10,11,12],use_custom_border_s:12,use_poryscript:12,used:[1,2,3,4,5,8,11,12,13],useful:[2,4,5,11],user:[0,1,7,9,11,12],uses:[1,3,5,6,10,12],using:[3,5,7,8,11,12],usual:11,util:[],valid:12,valu:[2,3,4,5,10,11,12],vanilla:6,var_valu:12,variabl:3,variou:[4,5,7,8],veri:[1,2,3,5,11],version:[1,3,4,7,11,12],vertic:[2,10,11],via:[11,12],video:13,view:[1,2,3,4,5,8,10,11,12],visibl:[3,5,11],vision:4,visual:[0,1,12],wai:[2,5,10,11],wait:11,walk:[1,2,3,8],want:[6,10,11],warn:12,warp:[0,8,12],weather:[0,4,8,9],web:11,websit:12,were:[11,12],weren:12,west:[1,2],what:[0,1,3,4,5,8,10],wheel:5,when:[1,2,3,4,5,7,8,10,11,12],whenev:[1,5,8,11],where:[10,11,12],whether:[1,4],which:[1,2,4,5,6,8,11,12],white:[1,5],whose:[],why:1,widget:12,width:[10,11],wild:[0,8,12],wild_encount:9,window:[0,3,4,5,6,7,10,12],within:[3,8],without:[5,11,12],woman:3,won:[1,11],work:[5,7,8,12],workflow:[7,11],would:[1,11,12],wouldn:12,wrap:5,write:[0,7,9,12],written:12,xdelta:11,ydelta:11,yes:9,yet:[],you:[0,1,2,3,4,5,6,7,8,10,12,13],your:[2,3,4,5,6,7,8,10],yourself:9,zoom:[5,10,12]},titles:["Porymap Documentation","Editing Map Collisions","Editing Map Connections","Editing Map Events","Editing Map Headers","Editing Map Tiles","Editing Wild Encounters","Introduction","Navigation","Project Files","The Region Map Editor","Scripting Capabilities","Changelog","Related Projects"],titleterms:{"break":12,"function":11,"new":6,Added:12,Adding:[3,6],The:10,about:7,action:11,api:11,background:10,base:3,border:5,bucket:5,callback:11,capabl:11,chang:[5,12],changelog:12,citi:10,collis:1,configur:6,connect:2,custom:11,delet:3,dive:2,document:0,edit:[1,2,3,4,5,6,11],editor:[8,10],emerg:2,encount:6,entri:10,event:3,field:6,file:9,fill:5,fix:12,follow:2,get:7,group:6,header:4,hidden:3,imag:10,introduct:7,item:3,layout:10,list:8,main:8,map:[1,2,3,4,5,8,10,11],metatil:5,mirror:2,navig:8,object:3,open:3,option:5,overlai:11,paint:1,path:5,pencil:5,pointer:5,porymap:[0,7],poryscript:[],posit:3,project:[9,13],redo:5,region:[8,10],regist:11,relat:13,script:[3,11],secret:3,select:[1,5],set:11,shift:5,sign:3,smart:5,start:7,tab:10,tile:5,tileset:[5,8,11],tool:5,trigger:3,type:1,undo:5,unreleas:12,util:11,visual:5,warp:[2,3],weather:3,wild:6,window:8,write:11}}) \ No newline at end of file +Search.setIndex({docnames:["index","manual/creating-new-maps","manual/editing-map-collisions","manual/editing-map-connections","manual/editing-map-events","manual/editing-map-header","manual/editing-map-tiles","manual/editing-wild-encounters","manual/introduction","manual/navigation","manual/project-files","manual/region-map-editor","manual/scripting-capabilities","reference/changelog","reference/related-projects"],envversion:{"sphinx.domains.c":2,"sphinx.domains.changeset":1,"sphinx.domains.citation":1,"sphinx.domains.cpp":2,"sphinx.domains.index":1,"sphinx.domains.javascript":2,"sphinx.domains.math":2,"sphinx.domains.python":2,"sphinx.domains.rst":2,"sphinx.domains.std":1,sphinx:56},filenames:["index.rst","manual/creating-new-maps.rst","manual/editing-map-collisions.rst","manual/editing-map-connections.rst","manual/editing-map-events.rst","manual/editing-map-header.rst","manual/editing-map-tiles.rst","manual/editing-wild-encounters.rst","manual/introduction.rst","manual/navigation.rst","manual/project-files.rst","manual/region-map-editor.rst","manual/scripting-capabilities.rst","reference/changelog.md","reference/related-projects.rst"],objects:{"":{onBlockChanged:[12,0,1,""],onMapOpened:[12,0,1,""],onProjectClosed:[12,0,1,""],onProjectOpened:[12,0,1,""]},map:{addFilledRect:[12,0,1,""],addImage:[12,0,1,""],addRect:[12,0,1,""],addText:[12,0,1,""],bucketFill:[12,0,1,""],bucketFillFromSelection:[12,0,1,""],clearOverlay:[12,0,1,""],getBlock:[12,0,1,""],getBorderVisibility:[12,0,1,""],getCollision:[12,0,1,""],getDimensions:[12,0,1,""],getElevation:[12,0,1,""],getGridVisibility:[12,0,1,""],getHeight:[12,0,1,""],getMetatileId:[12,0,1,""],getPrimaryTileset:[12,0,1,""],getPrimaryTilesetPalette:[12,0,1,""],getPrimaryTilesetPalettePreview:[12,0,1,""],getPrimaryTilesetPalettes:[12,0,1,""],getPrimaryTilesetPalettesPreview:[12,0,1,""],getSecondaryTileset:[12,0,1,""],getSecondaryTilesetPalette:[12,0,1,""],getSecondaryTilesetPalettePreview:[12,0,1,""],getSecondaryTilesetPalettes:[12,0,1,""],getSecondaryTilesetPalettesPreview:[12,0,1,""],getSmartPathsEnabled:[12,0,1,""],getWidth:[12,0,1,""],log:[12,0,1,""],magicFill:[12,0,1,""],magicFillFromSelection:[12,0,1,""],registerAction:[12,0,1,""],setBlock:[12,0,1,""],setBlocksFromSelection:[12,0,1,""],setBorderVisibility:[12,0,1,""],setCollision:[12,0,1,""],setDimensions:[12,0,1,""],setElevation:[12,0,1,""],setGridVisibility:[12,0,1,""],setHeight:[12,0,1,""],setMetatileId:[12,0,1,""],setPrimaryTileset:[12,0,1,""],setPrimaryTilesetPalette:[12,0,1,""],setPrimaryTilesetPalettePreview:[12,0,1,""],setPrimaryTilesetPalettes:[12,0,1,""],setPrimaryTilesetPalettesPreview:[12,0,1,""],setSecondaryTileset:[12,0,1,""],setSecondaryTilesetPalette:[12,0,1,""],setSecondaryTilesetPalettePreview:[12,0,1,""],setSecondaryTilesetPalettes:[12,0,1,""],setSecondaryTilesetPalettesPreview:[12,0,1,""],setSmartPathsEnabled:[12,0,1,""],setTimeout:[12,0,1,""],setWidth:[12,0,1,""],shift:[12,0,1,""]}},objnames:{"0":["js","function","JavaScript function"]},objtypes:{"0":"js:function"},terms:{"0e8ccfc4fd3544001f4c25fafd401f7558bdefba":13,"0x10":12,"0x11":12,"0x4":8,"0x8":12,"0x9":12,"3x3":6,"82abc164dc9f6a74fdf0c535cc1621b7ed05318b":13,"8x8":11,"boolean":12,"break":[],"case":[2,4],"const":12,"default":[4,6,7,9,12,13],"export":[12,13],"final":8,"function":[4,8,11],"import":[2,11,12,13],"long":[2,13],"new":[0,2,3,4,9,10,11,12,13],"pok\u00e9cent":4,"pok\u00e9mon":[4,6,9],"return":12,"switch":9,"true":[2,12],"try":[2,12],"var":[4,10],"while":[2,4,6,11,12],AND:4,Added:[],Adding:0,For:[1,2,3,4,5,6,7,9,12],Its:[8,13],NOT:12,One:[7,12],That:8,The:[0,1,2,4,5,6,7,8,9,12,13],Then:[2,7,12],There:[4,8,11],These:[2,3,6,7,11,12],Use:[4,6],Used:[4,5],With:12,_creat:[],a0ba1b7c6353f7e4f3066025514c05b323a0123d:13,a1ea3b5e394bc115ba9b86348c161094a00dcca7:13,aarrggbb:12,abil:[2,4,12,13],abl:[2,4,12],about:[0,12,13],abov:[2,4,6,8,9,11,12,13],accept:7,access:12,accomod:13,accomplish:6,accord:13,account:11,accur:13,act:13,action:[0,6],actionnam:12,activ:7,actual:[12,13],ad365a35c1536740cbcbc10bee66e5dd908c39e7:13,adb0a444577b59eb02788c782a3d04bc285be0ba:13,add:[1,3,4,7,11,12,13],added:[11,12],addfilledrect:12,addimag:12,adding:[7,11],addit:[5,8,12],addition:6,addrect:12,addtext:12,adher:13,adjust:[6,7],advanc:[8,13,14],affect:[11,12],after:[2,4,6,8,12],again:4,all:[2,3,4,6,7,9,11,12,13],allow:[1,2,5,6,7,8,9,12,13],along:2,also:[2,4,5,6,7,9,10,11,12,13],alter:7,altern:[1,4],alwai:[2,4],among:[],ani:[1,2,4,6,9,12,13],anim:12,anoth:[4,6,7,9],anyth:[4,6],api:0,appear:[6,9,11,13],append:[5,10],appli:12,applic:[9,13],applymov:4,applynighttint:12,appropri:2,area:[2,4,6,8,9,11,12,13],argument:12,around:[4,6,9,11,13],arrai:12,arriv:4,arrow:4,assign:[4,7],associ:[1,2,4,11],assum:12,auto:13,autocomplet:13,automat:[3,4,5,12],avail:[6,7,8,9,11],awai:7,awar:6,back:6,background:[0,5,9],base:[0,1,7,13],base_game_vers:13,basement:5,basic:[2,6,8,9],battl:[4,5],becaus:[2,4,9,11],been:13,befor:[2,6,8,11,12,13],begin:11,behav:[12,13],behavior:13,being:[2,8,13],bele:1,belong:5,below:[2,6,7,12,13],berri:4,between:[2,3,4,9,13],beyond:13,bg_event_const:[],bigger:6,bike:[1,5],binari:[8,11],black:12,blank:11,block:[1,2,12],blockdata:10,blue:4,boi:14,border:[0,1,4,10,12],both:[3,13],bottom:[6,9,11,13],bound:[4,13],boundari:13,box:[7,11],bread:6,bridg:2,briefli:9,bring:[4,7,9],browser:12,brush:12,bucket:[0,12],bucketfil:12,bucketfillfromselect:12,bug:13,build:[4,8,12],built:13,bulk:13,bump:13,butter:6,button:[3,4,6,7,8,9,11,13],bvd:13,c68ba9f4e8e260f2e3389eccd15f6ee5f4bdcd3:13,c73de8bed752ca538d90cfc93c4a9e8c7965f8c9:13,call:[6,12],callabl:12,can:[0,1,2,3,4,5,6,7,8,9,11,12,13],cannot:[1,5],capabl:[0,13],caus:13,cave:7,cdae0c1444bed98e652c87dc3e3edcecacfef8b:13,ceil:12,center:[1,4,6,9],certain:[4,10,13],cfg:[6,12,13],chanc:7,chang:[0,1,3,4,7,8,9,11,12],changelog:0,charact:[4,13],check:[4,6,7,12],checkbox:[3,6,13],choos:[4,6,7,8,9,12],citi:[0,3,8,9],clear:[11,12],clearoverlai:12,click:[1,2,3,4,6,7,8,9,11,12,13],cliff:2,close:[4,12,13],code:12,collaps:[9,13],collect:5,collid:12,collis:[0,4,8,9,12,13],color:[11,12,13,14],column:2,com:[0,13],combin:9,combobox:[11,13],comma:12,command:4,comment:13,commit:13,common:2,commonli:2,compar:[],compil:8,compos:11,comprehens:13,concept:2,config:[12,13],configur:[0,12,13],connect:[0,4,6,8,9,13],consist:13,constant:[10,11,12],contain:[9,13],context:9,contigu:[6,13],continu:2,control:[2,4,5,8],conveni:[6,13],coordin:[4,11,12],copi:[6,7,13],corner:[3,12],correctli:13,correspond:[4,11,13],corrupt:13,could:[12,13],count:2,coupl:12,cover:[4,9],crash:13,creat:[0,7,9,12,13],cross:8,ctrl:[3,4,6,8,11,12,13],cumbersom:12,current:[2,4,6,7,8,9,11,12,13],cursor:[6,11],custom:[0,1,5,6,11,13],custom_script:12,dai:[7,12],dark:13,data:[7,8,10,11,13],date:13,daunt:9,debug:12,decompil:[8,13,14],defin:[11,12,13],delai:12,delaym:12,delet:[0,3,11,13],demand:12,demonstr:6,denot:2,depend:[1,6,13],describ:7,desir:[3,6,9],despit:13,destin:[3,4],detail:[4,6,9,11],detect:12,determin:[2,4,11],diagonist:12,dialog:[8,9],did:13,diff:13,differ:[1,2,4,6,9,11,12,13],difficulti:8,dig:5,dimens:[6,11,12],direct:[2,3,4,13],directori:12,disabl:[6,7,13],disallow:13,disassembl:14,disk:[7,12],displai:[1,4,6,7,8,12,13],dissect:4,dive:0,document:[12,13],doe:[6,8],doesn:[2,6,12],doing:8,don:[3,13],done:11,doubl:[3,4,9,13],down:[6,7,8,13],download:8,drag:[3,4,6,11,13],draw:[8,11,13],drawn:12,drop:7,dropdown:[3,6],due:13,dummi:4,duplic:13,dure:[2,4,13],dynam:4,each:[2,4,5,7,9,11,12,13],easi:[1,4,6],easier:[6,13],easiest:3,east:[2,3],ecmascript:12,edit:[0,8,9,10,11,13],editor:[0,4,8,13,14],either:[2,6,9,12],element:12,elev:[1,2,4,12],els:[2,4],emerg:0,empti:[7,8,13],enabl:[3,6,12,13],encount:[0,13],end:[10,13],endless:12,enforc:7,engin:[4,5],enhanc:12,ensur:4,enter:[2,4,5,9,11],entir:[6,11,12,13],entranc:4,entri:0,equal:4,equival:8,eras:12,error:[12,13],escap:[1,5],essenti:12,etc:13,even:6,event:[0,1,3,8,9,12,13],event_bg:10,event_object_graph:[],event_object_graphics_info:[],event_object_graphics_info_point:[],event_object_mov:10,event_object_movement_const:[],event_object_pic_t:[],event_script:10,everi:[6,9],exactli:6,exampl:[1,2,3,4,5,6,11,12],except:[2,4],exclus:[4,5],execut:[4,12],exist:[1,4,6,8,12,13],expand:[5,9,13],explain:4,explanatori:5,explicitli:13,explor:2,extend:13,extens:[4,12,13],extra:13,extrem:3,eyedropp:6,face:[4,13],fake:12,familiar:8,fan:13,featur:[2,3,8,9],feel:0,few:[6,8,9],fewer:11,field:[0,4,5,6,13],field_event_obj:[],fieldmap:10,file:[0,3,4,6,8,9,11,12,13],filepath:12,fill:[0,2,12,13],filter:9,find:0,finish:2,first:[2,4,7,8,9,11,12],fix:[6,11],flag:[4,10,13],flash:5,flip:13,floor:[1,5,12],flow:[2,6],flower:8,floweri:8,fly:[1,4],folder:[1,8,9,13],follow:[0,8,12],font:12,fork:12,format:[6,13,14],found:[8,13],four:7,frlg:13,from:[1,2,4,6,7,8,9,10,11,12,13,14],front:4,full:13,fullest:9,func:12,functionnam:12,futur:11,game:[2,4,5,6,7,8,9,11,13,14],gameplai:[2,4,9],gen:[8,14],gener:[2,8,10,12],get:[0,6,12],getblock:12,getbordervis:12,getcollis:12,getdimens:12,getelev:12,getgridvis:12,getheight:12,getmetatileid:12,getprimarytileset:12,getprimarytilesetpalett:12,getprimarytilesetpalettepreview:12,getprimarytilesetpalettespreview:12,getsecondarytileset:12,getsecondarytilesetpalett:12,getsecondarytilesetpalettepreview:12,getsecondarytilesetpalettespreview:12,getsmartpathsen:12,getwidth:12,gif:6,git:[4,8],github:[0,13],give:[7,9],given:[7,12],global:[4,12],goe:12,going:4,good:[10,12],gpl:13,graphic:[5,10,13],grass:[2,8,12],grasstil:12,great:8,green:[4,7],greet:8,grid:[6,12,13],group:[0,1,4,9,13],grow:13,guarante:13,hack:8,half:[2,11],handl:13,happen:[4,12,13],hardcod:[4,13],has:[2,3,4,5,9,13],have:[2,3,4,6,7,8,9,11,12,13],head:11,headbutt_mon:7,header:[0,9,10,13],heal:[0,1,13],heal_loc:[4,10],healspot:0,height:[1,11,12],help:[6,13],here:[2,12],hexadecim:2,hidden:[0,13],hide:5,hierarch:9,high:14,highli:8,higlight:11,histori:2,hit:13,hold:[4,6,13],hop:2,horizont:[3,12],hous:13,hover:[6,13],how:[2,4,6,8,9,12],howev:[4,12],html:[],http:[0,13],huderlem:[0,13],icon:[6,10,13],idea:10,ident:[2,6],ignor:8,illustr:[2,6],imag:[0,4,6,9,10,12,13],impass:[2,12],implement:7,implicitli:12,improperli:13,improv:8,inc:[4,10,13],includ:[2,4,6,7,9,10,11],incorrect:13,index:[7,11,12,13],indexof:12,indic:6,individu:13,indoor:1,inform:[12,13],initi:[12,13],insert:[11,12],insid:4,instal:8,instanc:11,instead:12,integ:13,integr:[10,13],interact:[2,4,9,12],interest:12,interpret:13,interv:12,introduc:13,introduct:0,invalid:13,invis:4,involv:4,issu:13,item:[0,5,10,12,13],itemfind:4,iter:13,its:[4,6],itself:12,jasc:13,javascript:[12,13],json:[7,10,13],jump:13,junk:13,just:[1,2,6,7],kanto:13,keep:[3,5,13],keepachangelog:[],kei:[6,13],keyboard:[12,13],known:4,label:13,laid:6,land:2,languag:14,larg:[6,13],larger:9,last:13,later:12,launch:[8,12],layer:13,layout:[0,1,9,10,13],layouts_t:13,learn:[6,8,9],leav:2,left:[2,6,8,9,11,12],length:12,let:[2,4,6,7,8,9,11,12,14],level:[2,7,10,14],life:[4,6],like:[2,4,6,9,11,13],limit:5,line:[4,13],link:11,linux:8,list:[0,1,10,13],listen:14,littl:4,load:[8,9,12],local:4,locat:[0,1,5,6,8,11,13],log:[12,13],logic:12,longer:[4,13],look:[0,4,8,9,11],mac:[8,13],maco:13,made:[7,11,13],magic:[12,13],magicfil:12,magicfillfromselect:12,mai:[1,4,7],main:[0,6,7,8,11],maintain:[2,10],major:13,make:[2,4,6,8,11,13],mani:[4,8,9],manipul:7,manual:[0,12],map:[0,7,8,10,13,14],map_group:10,map_groups_count:13,map_typ:10,map_type_indoor:5,mapnam:12,mapsec_new_mapsec:11,mapsec_non:11,mark:4,match:[4,6,13],math:12,max:[10,12,13],maximum:7,mean:[2,3,4,12],meant:14,menu:[3,7,12,13],messag:12,metatil:[0,1,2,4,8,9,10,12,13],metatile_behavior:10,metatile_label:10,metatileid:12,method:6,middl:6,might:[7,12],millisecond:12,mimic:13,min:[10,12,13],minimum:7,minor:13,mirror:0,miscellan:[5,12],miss:[0,13],mistak:[6,11],mode:[1,9,13],modif:2,modifi:[6,9,11,12,13],monitor:13,more:[4,6,8,9,11,13],most:[2,8,9],mostli:5,mountain:[2,6],mous:[6,11,13],move:[2,3,4,5,13],movement:[4,13],much:8,multi:[2,13],multilin:13,multipl:[4,6,7,12,13],music:[5,9,14],must:[3,4,6,7,8,11],my_script:12,name:[1,4,5,7,9,10,11,12,13],navig:[0,3,4,7,8,11,13],nearli:2,need:[2,3,4,5,6,13],neg:5,never:4,newblock:12,newli:13,next:[2,4,7,8,9,12,13],nice:12,night:12,nodej:12,nodep:8,non:4,none:[],normal:4,north:2,notabl:[8,13],note:[5,10],noth:4,notic:11,now:[2,6,7,8,12,13],npc:4,number:[1,2,4,5,7,12,13],object:[0,2,9,12,13],object_ev:10,object_event_graph:10,object_event_graphics_info:10,object_event_graphics_info_point:10,object_event_pic_t:10,occur:[12,13],odd:4,off:[2,6,13],offici:13,offset:[3,13],old:13,onblockchang:12,onc:[4,6],one:[2,3,6,7,9],onli:[2,3,4,6,7,9,10,11,12,13],onmapopen:12,onprojectclos:12,onprojectopen:12,onto:[2,6,9,11,12],open:[0,3,7,8,9,11,12,13],oper:[9,12],option:[0,9,12,13],order:[1,4,7,11,13],org:[],organ:9,origin:[4,11],other:[4,6,9,12,13,14],otherwis:[7,10,12],our:[7,8,12],out:[0,4,6,7,11,12,13],outdoor:1,outlin:[6,12,13],outsid:13,over:[2,4,5,6,9],overhaul:13,overview:12,overworld:4,overwrit:12,own:11,paint:[0,6,8,9,11,12,13],pal:13,palett:[10,11,12,13],paletteindex:12,pane:[6,9,11,13],panel:[8,13],pars:13,part:9,partial:13,particular:2,passabl:12,patch:12,path:[0,2,12,13],pathwai:6,patient:9,pattern:[6,12],pencil:[0,8,13],perform:[6,12],perman:12,petalburg:[3,8],pick:4,picker:6,pictur:7,pink:4,pixel:[11,12],place:[6,8,11,12],plai:5,platform:8,player:[1,2,3,4,6,9,11,13],pleas:0,plu:[3,4],png:13,pointer:[0,13],pokecryst:14,pokeemerald:[4,6,8,9,10,11,13],pokefir:[4,5,6,8,12,13],pokemon:[1,7,9,10,13],poker:14,pokerubi:[4,6,8,9,10,11,13],polish:14,pond:6,pop:8,popul:[7,11],popular:14,popup:[1,5,11],portion:6,porymap:[1,3,4,6,7,9,10,11,12,13],poryscript:[13,14],posit:[0,6,11],possibl:[7,11,12,13],power:[6,12],pre:13,prefix:[5,13],press:[3,4,8,9,11,13],pret:[8,13],pretti:7,prevblock:12,prevent:13,preview:[6,12],previou:2,previous:12,primari:[1,6,8,9,12],probabl:[10,12],procedur:12,process:2,program:14,project:[0,1,4,5,6,8,9,12,13],projectpath:12,prompt:13,properli:13,properti:[2,4,5,8,9,12,13],provid:[6,7,8,12,13],pull:13,purpos:[2,9],quantiti:4,quick:6,quickli:9,radiu:[4,6],randint:12,random:12,rang:4,rate:7,rather:[6,13],ratio:7,raw:11,rawvalu:12,reach:0,read:[8,10,13],reason:7,receiv:4,recommend:8,rectangl:[6,12,13],red:[2,7],redo:[0,2,4,8,11],refer:0,refresh:12,region:[0,1,5,6,8,13],region_map:[10,11],region_map_entri:[10,11],region_map_sect:[10,11],regist:0,registeract:12,registri:13,regress:13,regular:6,rejoic:13,relat:[0,10,12],releas:[8,13],reli:10,reload:13,rememb:[2,12],render:13,replac:4,repo:13,report:13,repres:[2,7],requir:[4,5,11,13],reset:11,resili:13,resiz:[6,13],respawn:4,respect:[8,13],rest:12,restor:13,result:8,retriev:12,rgb:12,right:[1,2,3,4,6,7,9,11,13],rival:4,rme:11,rom:8,rooftop:5,rop:[],rope:[1,5],rout:[2,3],row:[2,13],rrggbb:12,rubi:5,run:[1,5,12],same:[2,4,6,8,11,12,13],save:[3,6,7,8,12,13],scenario:13,scene:5,screen:[7,8],script:[0,9,10,13,14],scroll:6,seamlessli:3,second:[2,8,9],secondari:[1,6,9,12],secret:[0,13],secret_bas:[4,10],section:[1,4,5,9,11],see:[1,4,6,7,8,9,12],seem:9,seen:13,select:[0,3,4,7,8,9,11,12,13],selector:[2,11,13],self:5,semant:13,semver:[],sensibl:13,separ:12,session:13,set:[4,6,7,9,11,13],setblock:12,setblocksfromselect:12,setbordervis:12,setcollis:12,setdimens:12,setelev:12,setgridvis:12,setheight:12,setmetatileid:12,setprimarytileset:12,setprimarytilesetpalett:12,setprimarytilesetpalettepreview:12,setprimarytilesetpalettespreview:12,setsecondarytileset:12,setsecondarytilesetpalett:12,setsecondarytilesetpalettepreview:12,setsecondarytilesetpalettespreview:12,setsmartpathsen:12,settimeout:12,setup:8,setwhiteoutrespawnwarpandhealernpc:4,setwidth:12,sever:[7,12],shape:12,share:11,shift:[0,3,12,13],shoe:5,shortcut:[2,6,8,12,13],should:[2,4,6,7,8,12],shouldn:8,show:[5,6,8,9,12,13],shrink:13,side:[2,3,6,8,9],sight:4,sign:[0,13],signpost:[2,4],similar:[2,3,7],simpl:[4,7],simpli:[3,4,6,9,11],simplifi:6,sinc:[3,8,12,13],singl:[7,9,11],situat:9,size:[6,11,12,13],slider:[2,6,11,13],slot:7,small:4,smart:[0,2,12,13],smooth:13,snap:6,some:[1,2,4,6,8,9,12],someth:[0,2,4,7],sometim:13,somewhat:13,song:5,sort:[1,9,13],sourc:8,south:2,span:11,spec:[],speci:7,special:[2,4],specif:[4,13],specifi:[4,12,13],spinbox:11,spinner:[4,13],split:11,spot:4,sprint:1,sprite:[4,10,13],squar:[4,11,13],src:[4,10,11],ssecretbaseentrancemetatil:4,stai:13,stair:2,stand:4,start:[0,2,11,12],startup:13,state:12,statu:13,still:13,stitch:13,store:11,straightforward:7,strict:11,string:[12,13],studio:14,stuff:[],successfulli:[8,12],summar:9,support:[5,6,8,12,13],sure:[2,3,8],surf:2,surround:[6,9],swap:11,sync:3,system:13,tab:[0,2,3,4,7,9,13],tabl:13,take:[6,7,8,9,11,12],technic:[4,12],test:12,text:[2,4,9,12],than:[6,13],thei:[1,3,4,5,6,9],them:[2,3,4,5,7,12,13],theme:13,therefor:[7,8,11],thi:[1,2,3,4,5,6,7,9,10,11,12,13],thing:[4,5,6,7,8,9],think:[6,8],those:8,though:[6,13],three:[4,11],through:[2,3,13],tied:11,tile:[0,2,4,8,9,10,11,12,13],tilemap:14,tileset:[0,1,8,10,13],time:[2,4,6,7,8,9,12,13],tint:12,togeth:3,toggl:[6,12,13],too:[2,13],tool:[0,1,2,8,11,12,13],toolbar:[6,8],top:[2,3,4,11,12,13],total:[2,7],tpl:13,tradit:8,trainer:[4,13],trainer_sight_or_berry_tree_id:13,trainer_typ:[10,13],trainer_type_norm:4,transit:[2,4],transpar:[2,13],tree:[4,6],trigger:[0,9,12],two:[3,6,9,11],type:[0,1,4,5,9,11,13],typic:[2,4],unabl:2,unavail:4,under:[2,11],underli:[12,13],undertand:2,underw:13,undo:[0,2,4,8,11],unfortun:4,unhappi:11,uniq:7,uniqu:4,unless:10,unlik:2,unreleas:0,unsav:13,until:7,updat:[2,3,6,11,13],upstream:13,usabl:8,use:[1,2,4,6,7,8,9,11,12,13],use_custom_border_s:[6,13],use_poryscript:13,used:[2,3,4,5,6,9,12,13,14],useful:[3,5,6,12],user:[0,1,2,8,10,12,13],uses:[2,4,6,7,11,13],using:[4,6,8,9,12,13],usual:12,valid:13,valu:[3,4,5,6,11,12,13],vanilla:7,var_valu:13,variabl:4,variou:[5,6,8,9],veri:[2,3,4,6,12],version:[2,4,5,8,12,13],vertic:[3,11,12],via:[6,12,13],video:14,view:[2,3,4,5,6,9,11,12,13],visibl:[4,6,12],vision:5,visual:[0,2,13],wai:[3,6,11,12],wait:12,walk:[2,3,4,9],want:[7,11,12],warn:13,warp:[0,9,13],weather:[0,5,9,10],web:12,websit:13,were:[4,12,13],weren:13,west:[2,3],what:[0,2,4,5,6,9,11],wheel:6,when:[1,2,3,4,5,6,8,9,11,12,13],whenev:[2,6,9,12],where:[4,11,12,13],whether:[1,2,5],which:[1,2,3,5,6,7,9,12,13],white:[2,4,6],why:2,widget:13,width:[1,11,12],wild:[0,9,13],wild_encount:10,window:[0,1,4,5,6,7,8,11,13],within:[4,9],without:[6,12,13],woman:4,won:[2,12],work:[6,8,9,13],workflow:[8,12],would:[2,12,13],wouldn:13,wrap:6,write:[0,8,10,13],written:13,xdelta:12,ydelta:12,yes:10,you:[0,1,2,3,4,5,6,7,8,9,11,13,14],your:[1,3,4,5,6,7,8,9,11],yourself:10,zoom:[6,11,13]},titles:["Porymap Documentation","Creating New Maps","Editing Map Collisions","Editing Map Connections","Editing Map Events","Editing Map Headers","Editing Map Tiles","Editing Wild Encounters","Introduction","Navigation","Project Files","The Region Map Editor","Scripting Capabilities","Changelog","Related Projects"],titleterms:{"break":13,"function":12,"new":[1,7],Added:13,Adding:[4,7],The:11,about:8,action:12,api:12,background:11,base:4,border:6,bucket:6,callback:12,capabl:12,chang:[6,13],changelog:13,citi:11,collis:2,configur:7,connect:3,creat:1,custom:12,delet:4,dive:3,document:0,edit:[2,3,4,5,6,7,12],editor:[9,11],emerg:3,encount:7,entri:11,event:4,field:7,file:10,fill:6,fix:13,follow:3,get:8,group:7,header:5,heal:4,healspot:4,hidden:4,imag:11,introduct:8,item:4,layout:11,list:9,locat:4,main:9,map:[1,2,3,4,5,6,9,11,12],metatil:6,mirror:3,navig:9,object:4,open:4,option:[1,6],overlai:12,paint:2,path:6,pencil:6,pointer:6,porymap:[0,8],posit:4,project:[10,14],redo:6,region:[9,11],regist:12,relat:14,script:[4,12],secret:4,select:[2,6],set:12,shift:6,sign:4,smart:6,start:8,tab:11,tile:6,tileset:[6,9,12],tool:6,trigger:4,type:2,undo:6,unreleas:13,util:12,visual:6,warp:[3,4],weather:4,wild:7,window:9,write:12}}) \ No newline at end of file diff --git a/docsrc/conf.py b/docsrc/conf.py index b82c4f3e..3a69ac55 100644 --- a/docsrc/conf.py +++ b/docsrc/conf.py @@ -45,8 +45,11 @@ templates_path = ['_templates'] # You can specify multiple suffix as a list of string: # -from recommonmark.parser import CommonMarkParser +# sphinx >= 1.4 +extensions = ['recommonmark'] +# sphinx <= 1.3 +from recommonmark.parser import CommonMarkParser source_suffix = ['.rst', '.md'] source_parsers = { '.md': CommonMarkParser, diff --git a/docsrc/index.rst b/docsrc/index.rst index 4b13288f..9fa9081c 100644 --- a/docsrc/index.rst +++ b/docsrc/index.rst @@ -16,6 +16,7 @@ Porymap Documentation manual/editing-map-header manual/editing-map-connections manual/editing-wild-encounters + manual/creating-new-maps manual/region-map-editor manual/scripting-capabilities manual/project-files diff --git a/docsrc/manual/creating-new-maps.rst b/docsrc/manual/creating-new-maps.rst new file mode 100644 index 00000000..3f7387c7 --- /dev/null +++ b/docsrc/manual/creating-new-maps.rst @@ -0,0 +1,73 @@ +.. _creating-new-maps: + +***************** +Creating New Maps +***************** + +Creating a new map in porymap is easy! Just click *Tools -> New Map...*. +Alternatively, in any of the map list sort modes, you can right click on a folder +in order to add a new map to the folder. + +For example, when sorting maps by their layout, you can add a new Pokemon Center from the existing layout. + +.. figure:: images/creating-new-maps/right-click-layout-sort.png + :alt: Add New Map with Layout + + Add New Map with Layout + +New Map Options +--------------- + +The popup window when you create a new map will display some options in order to customize your new map. + +.. figure:: images/creating-new-maps/new-map-options-window.png + :alt: New Map Options Window + + New Map Options Window + +The options you see may be different depending on your base project, but they are: + +Name + The name of the new map. This cannot be changed in porymap. + +Group + Which map group the new map will beling to. This cannot be changed in porymap. + +Map Width + The width (in metatiles) of the map. This can be changed in porymap. + +Map Height + The height (in metatiles) of the map. This can be changed in porymap. + +Border Width + The width (in metatiles) of the map border blocks. This can be changed in porymap. + +Border Height + The height (in metatiles) of the map border blocks. This can be changed in porymap. + +Primary Tileset + The map's primary tileset. This can be changed in porymap. + +Secondary Tileset + The map's secondary tileset. This can be changed in porymap. + +Type + Whether this map is an indoor or outdoor map. This can be changed in porymap. + +Location + The region map section this map exists in. This can be changed in porymap. + +Can Fly To + Whether a heal location event will be created with this map. This cannot be changed in porymap. + +Allow Running + Whether the player can sprint on this map. This can be changed in porymap. + +Allow Biking + Whether the player can use the bike on this map. This can be changed in porymap. + +Allow Escape Rope + Whether the user can escape from this map. This can be changed in porymap. + +Floor Number + The floor number for this map if it is associated with an elevator. This can be changed in porymap. diff --git a/docsrc/manual/images/creating-new-maps/new-map-options-window.png b/docsrc/manual/images/creating-new-maps/new-map-options-window.png new file mode 100644 index 00000000..caad5a11 Binary files /dev/null and b/docsrc/manual/images/creating-new-maps/new-map-options-window.png differ diff --git a/docsrc/manual/images/creating-new-maps/right-click-layout-sort.png b/docsrc/manual/images/creating-new-maps/right-click-layout-sort.png new file mode 100644 index 00000000..f96265b5 Binary files /dev/null and b/docsrc/manual/images/creating-new-maps/right-click-layout-sort.png differ diff --git a/docsrc/manual/navigation.rst b/docsrc/manual/navigation.rst index bc25e9a9..afade419 100644 --- a/docsrc/manual/navigation.rst +++ b/docsrc/manual/navigation.rst @@ -25,6 +25,8 @@ Sort by Area Sort by Layout Organizes by map layouts. Most layouts are only used by a single map, but layouts like the Pokemon Center are used by many maps. +Right-clicking on the folder name in any of the sort modes will bring up a dialog to create a new map in that folder. For more details, see: :ref:`Creating New Maps `. + The *Expand All* |expand-all-button| and *Collapse All* |collapse-all-button| buttons will expand or collapse all of the map folders. Type in the filter to show maps that contain the filter text.